KEGG   Stigmatella aurantiaca: STAUR_6726Help
Entry
STAUR_6726        CDS       T01425                                 

Definition
(GenBank) Secretion protein, HlyD family
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
sur  Stigmatella aurantiaca
Brite
KEGG Orthology (KO) [BR:sur00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sur02000]
    STAUR_6726
Transporters [BR:sur02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   STAUR_6726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 HlyD_3 Biotin_lipoyl_2 HlyD Biotin_lipoyl OEP PTS_EIIA_1 Golgin_A5 HMMR_N FliJ MscS_porin
Motif
Other DBs
NCBI-ProteinID: ADO74483
UniProt: Q08VR9
LinkDB All DBs
Position
8238209..8239441
Genome map
AA seq 410 aa AA seqDB search
MAATLAPAPVDTSPSATAERVKPKGRARIVLPALLGVALLGGLIRFLFTHGRESTDDAQV
EGRIGNVAPRVAGQVMKVLVKDNQPVKAGDVLVELDRSDLDAKLQVAQADVLSAEAQLSN
AQAQLALTEANAGATLRQAQAGVTQASSGISSSKAALEQARADVASVEARFRLTDTELAR
VKRLAAEGALSPAELDTRQAAYDQAKAALDQAKARLASTEAGITSSSGGLEAAQGKLVAA
QTGPVQVQAAQAALKLAEARLQQSRASLHLAELAVSYTQVRAPINGVVSRRTVEVGQMVG
PERPLMAIVPQDDVWVVANFKEDQVGGMRPGQPVDVKVDAFGSQHFRAHVDSLAGASGAR
FALLPPDNASGNFVKVVQRIPVLVRFDGDLKELPLKPGMSAVVTVDTREP
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggccgctaccctcgcccctgccccggttgatacgtccccttccgccaccgccgagcgc
gtcaagcccaagggccgcgcccgcatcgtcctccccgccctgctgggcgtggcactgctc
ggagggctgatccgcttcctcttcacccatggccgcgagtccacggatgacgcgcaggtg
gagggccgcatcggcaacgtggccccgcgcgtggctgggcaggtgatgaaggtgctggtg
aaggacaaccagccggtgaaggccggggacgtcctggtggagctcgaccgcagcgacctg
gacgcgaagctccaggtggcccaggcggacgtgctgagcgccgaggcgcagctgtccaac
gcgcaggcgcaactggccctcaccgaggccaacgcgggggccaccctgcggcaggcccag
gcaggggtgacgcaggcctccagcggcatctcgtcctccaaggcggccctggagcaggca
cgcgccgatgtggcctcggtcgaggcgcgcttccggctgacggacacggagctggcccgc
gtgaagcggctggccgccgagggggccctgtcccccgcggagctggacacgcgccaggcc
gcgtatgaccaggccaaggccgcgctggatcaggccaaggcgcgcctggcctccaccgag
gccggcatcaccagttcctcgggaggcctggaggccgcacagggcaagctggtggccgcg
cagaccgggcccgtgcaagtgcaggcggcccaggcggccctgaagctggccgaagcgcgg
ctgcagcagtcccgcgcctccttgcatctggccgagctggccgtctcctacacccaggtg
cgcgcgcccatcaacggcgtggtgagccgccgcacggtggaggtggggcagatggtcggc
cccgagcgccccctgatggccatcgttccccaggatgacgtgtgggtggtggccaacttc
aaggaggaccaggtgggcgggatgcgcccgggccagccggtggatgtgaaggtggacgcc
tttggcagccagcacttcagggcgcatgtggacagcctggcgggcgccagcggcgcgcgc
ttcgcgctgctgcccccggacaacgcctccggcaacttcgtgaaggtggtgcaacgcatc
cccgtgctggtgcgcttcgacggggacctgaaggaactgccgctgaagccgggcatgagc
gccgtcgtcacggtggacacgcgggagccgtag

DBGET integrated database retrieval system