KEGG   Stigmatella aurantiaca: STAUR_6965Help
Entry
STAUR_6965        CDS       T01425                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sur00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    STAUR_6965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sur02000]
    STAUR_6965
Enzymes [BR:sur01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     STAUR_6965
Transporters [BR:sur02000]
 Other Transporters
  Pores ion channels [TC:1]
   STAUR_6965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 Tom37 GST_C_3 DUF2537
Motif
Other DBs
NCBI-ProteinID: ADO74721
UniProt: Q09E69
LinkDB All DBs
Position
complement(8507198..8507827)
Genome map
AA seq 209 aa AA seqDB search
MSGDLVFYHNPQSRAQMVHWMLHEVGAPFRVVRIDLQKGEQKSPEFLAVNPMGKLPALVH
DGTVVTETAAIITYLADAFPQAGLAPSAGDTRRGTYLRWLFFGAGCFEPALLDMMLKRPQ
VDSKSTIGYGSYEDTLGAFKKMLTPGPYILGGQFSAADVYVGSQIAWALSFKAPGLQEPI
FTDYVARITARPAYKKAAIADGRLPADKA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgagcggagacctcgttttctatcacaaccctcagtcgcgggcgcagatggtccactgg
atgctgcacgaggtgggagcgcccttccgcgtcgtgcgcatcgacctgcaaaaaggagag
cagaagtcaccggaatttctcgccgtcaacccgatgggcaagttgccggcgctcgtccat
gacggcaccgtcgtcaccgagacggcggccatcatcacctacctggccgatgccttcccg
caggcggggctcgcgccgtcggcaggcgacacgcgccgcggcacctatctgcgctggctc
ttttttggcgcggggtgtttcgagcctgccctgctcgacatgatgctcaagcgcccgcag
gtcgacagcaagagcaccatcggctatggcagctacgaggacacgctcggcgcgttcaag
aagatgctcaccccgggcccatacatccttggcgggcagttcagcgcggcggacgtctac
gtgggctctcagatcgcctgggccctttcgttcaaggcgccgggtctccaggaaccgatc
ttcacggactacgtggcgcgcatcaccgcgcgtcccgcctacaagaaggccgccatcgcc
gatggccgcctgcctgctgacaaggcctga

DBGET integrated database retrieval system