KEGG   Sporosarcina ureae: SporoP32a_00105Help
Entry
SporoP32a_00105   CDS       T04877                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sure  Sporosarcina ureae
Brite
Enzymes [BR:sure01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SporoP32a_00105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N bZIP_Maf
Motif
Other DBs
NCBI-ProteinID: ARK20088
LinkDB All DBs
Position
17254..17862
Genome map
AA seq 202 aa AA seqDB search
MAYTLPELPYAYDALEPHIDKETMNIHHTKHHNTYVTNVNNALEGHEELLNMPVDELVAN
LDKVPEDKRTAVRNNGGGHSNHSLFWTILSPNGGGNPTGEVAEAIDKKFGSFDAFKEEFA
KAATTRFGSGWAWLVVNNGEIEVTSTPNQDSPYMDGKTPLLGLDVWEHAYYLNYQNRRPD
YISAFWNVVNWDEVEKRYQDNK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcttatacattaccagaactaccatacgcatatgatgcgttggagccacacatcgac
aaagaaacgatgaacatccatcacacaaaacaccacaacacgtatgtaacaaacgtgaac
aacgcactagaagggcacgaagaacttcttaacatgcctgttgacgaattagttgcaaac
ttggacaaagttccagaggacaagcgtacagcagtccgtaataacggtggtgggcactct
aaccactcattgttctggacaatcctttcaccaaacggtggcggcaacccaactggagaa
gttgcagaagcaatcgacaagaagttcggtagctttgacgctttcaaagaagagttcgct
aaagctgcaacaactcgcttcggttcaggttgggcttggcttgttgtgaacaacggtgaa
attgaagtaacatcaactcctaaccaagactcaccttatatggatggtaaaacaccatta
ctaggtttggacgtttgggagcatgcatactacttaaactaccaaaaccgtcgtcctgac
tacatttcagcattctggaacgtagtaaactgggatgaagttgaaaagcgttaccaagac
aataaataa

DBGET integrated database retrieval system