KEGG   Sporosarcina ureae: SporoP32a_08430Help
Entry
SporoP32a_08430   CDS       T04877                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
sure  Sporosarcina ureae
Pathway
sure00010  Glycolysis / Gluconeogenesis
sure00620  Pyruvate metabolism
sure01100  Metabolic pathways
sure01110  Biosynthesis of secondary metabolites
sure01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sure00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SporoP32a_08430
   00620 Pyruvate metabolism
    SporoP32a_08430
Enzymes [BR:sure01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     SporoP32a_08430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ARK21555
LinkDB All DBs
Position
complement(1688723..1690264)
Genome map
AA seq 513 aa AA seqDB search
MVQASENLVYANPNTEGSKVQFKERYENFIGGKWTAPVKGQYFDNSTPVTGKVFTQVARS
TEEDIELALDAAHAAKDAWGKTSVTERSNILLKIADRIEENLEMLAVAETWDNGKAVRET
LNADLPLAVDHFRYFASAIRAQEGGVSQIDNDTVAYHFHEPLGVVGQIIPWNFPILMAVW
KLAPALAAGNCVVLKPAEQTPASILVLVELIEDLLPAGVLNVVNGFGLEAGKPLASNPRI
NKIAFTGETTTGRLIMQYASQNLIPVTLELGGKSPNIFFEDVMAEDDAFLDKAVEGFVMF
ALNQGEVCTCPSRALIQESIYDKFMERALERVKAIKTGNPLDPTVMMGAQASTEQLEKIL
SYLDIGKQEGAECLTGGEQNKLEGDLAEGYYVQPTVFKGHNKMRIFQEEIFGPVVAVTTF
KDKEEALEIANDTLYGLGSGVWTRDMNTAYRFGRGIQAGRVWTNCYHAYPAHSAFGGYKA
SGIGRENHLQMLAHYQQTKNMLVSYDESKQGFF
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggtacaagcttcagaaaatctagtttacgcaaatccaaatacagaaggttcaaaggtt
cagttcaaagaacgctatgaaaatttcattggcggcaagtggacggcgccagtcaaaggt
cagtatttcgataattcaacaccagtgacaggtaaagtgtttactcaggtagcgagatct
acagaagaagacattgaactagctctggatgcagctcatgcagcaaaagacgcgtgggga
aaaacatcagtcactgaacgttcaaatattttgctaaaaattgcagatcgtattgaagag
aacttagaaatgcttgctgtagctgaaacatgggataacggaaaagccgttcgtgaaaca
ttgaatgccgatcttccgctagcagttgaccatttcagatactttgcttctgcaattcgc
gcgcaagaaggcggagtcagtcaaatcgataacgacacagtagcttatcacttccatgag
ccactaggagtcgtaggtcagatcattccttggaacttccctattctaatggcagtatgg
aaacttgctccggcattagcggcaggaaattgtgtcgtgctaaaaccggctgaacaaacg
cctgcatctattttggtattggttgaattaatcgaagacttactgccggcaggtgtgctg
aacgtagtcaacggtttcggactagaagcaggaaagccattagcttccaatccacgtatc
aataagattgcattcacaggggagacgacaacaggccgtctgatcatgcagtatgcttct
caaaacttgattccggttactttggaattgggcggaaaatccccgaacattttcttcgaa
gatgtaatggcggaagatgatgcattccttgataaagcagttgaaggtttcgtaatgttc
gcattaaaccaaggagaggtctgtacatgcccatctcgtgcgttgattcaggaatccatt
tacgataagttcatggaacgtgcacttgagcgtgttaaagcgatcaagacaggaaatcca
ttagatccaacggtcatgatgggtgcccaggcatcgactgagcaactagagaagattctt
tcttacctagatatcggaaagcaagaaggtgcagaatgtctaacaggtggagagcaaaat
aagctcgaaggtgatcttgcagaaggttattatgtgcagccgactgtatttaaaggacat
aataagatgagaatcttccaagaagaaattttcggtcctgtagttgcagtaacgacgttt
aaagataaagaagaggcgctagaaattgcgaacgatacattgtatggactaggttcaggt
gtgtggacgcgtgatatgaatacagcgtaccgcttcggtcgcgggattcaggcaggacgc
gtatggacgaactgctatcatgcatatccggcacactctgctttcggtggctataaagct
tcgggtatcggccgtgaaaatcacttacagatgctagctcattatcagcagacaaagaac
atgctagttagctacgatgaaagcaaacaaggattcttttga

DBGET integrated database retrieval system