KEGG   Sporosarcina ureae: SporoP32a_11685Help
Entry
SporoP32a_11685   CDS       T04877                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
sure  Sporosarcina ureae
Pathway
sure00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:sure00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SporoP32a_11685
Enzymes [BR:sure01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     SporoP32a_11685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: ARK22124
LinkDB All DBs
Position
2370456..2371931
Genome map
AA seq 491 aa AA seqDB search
MKLTNYIDGVWQGEAARYTAVLNPANGEELAQVPLSSEEEVDQAVVAAKKAQKKWALVPA
PKRADYLYEIGRMMKDKKEHLARVLTKEMGKVIEEARGEVQEGIDMAFYMAGEGRRLFGE
TVPSELQDKFAMSVRAPIGVVGLITPWNFPIAIATWKSFPAIVAGNTFIWKPATETPLMA
YEMALIFEGAGLPHGVANIVFGSGSDVGTALIEHPDVRVISFTGSTETGRHVAELGGRHL
KKVSLEMGGKNAVIVLEDADIELAVEGILWSAFGTAGQRCTACSRVIVHQDVKEELQKRL
IESMKDLTMGDGLDETVKVGPVINEKALEKIQSYIEIGKEEGANLVAGGNVLNEGKFASG
QYFEPTLFVDVAWDSRLAQEEIFGPVVSLITVSSLDEAIEVNNSVAYGLSSSIFSQDVNK
VFRAQRDLDTGIVYINAGTTGAEIHLPFGGTKGTGNGHRDSGVAALDVFTEWKSIYIDYS
GKLQRAQIDTE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgactaattatattgatggtgtttggcaaggggaggcggctcgttatacggct
gtgcttaatccggcgaatggggaagagttggcgcaggtgcctttgtcttcggaggaagag
gtagatcaggcggttgtggcggcgaagaaggcgcagaagaagtgggctttggtgccggca
cctaagcgtgcggattatctctatgaaatcggccgcatgatgaaagataaaaaagagcat
ctcgcacgcgtgctgacgaaggaaatgggtaaagtaatagaagaagcgcgtggtgaagtg
caagagggaatcgatatggcgttttacatggcaggagaagggcgtcgtttgtttggtgaa
acggtgccgtccgagctgcaggataagttcgcgatgagtgttcgtgcaccgattggcgtg
gtgggtctgattacaccgtggaatttcccgattgcgattgcgacgtggaagtcgttcccg
gcaattgtggcgggcaatacattcatctggaaaccggcgacggaaactccactcatggcg
tatgaaatggcgttgattttcgaaggagctggcttgccgcatggcgtggcgaatatcgtc
tttggttcaggctcagatgttggtacagcgctgatcgaacatcccgacgttcgcgtaatt
tcgtttactggctcgacggaaacaggtcgacatgtcgcggagttgggcggtcgtcacttg
aagaaagtatcgcttgaaatgggtggcaaaaacgcggtcatcgtattggaagacgcagat
atcgagctcgcggtcgaagggattttatggagcgcatttggaacggcggggcagcgttgc
acagcttgcagtcgcgtgattgttcatcaagatgtcaaagaagagttgcagaaacgtctg
atcgaaagtatgaaagatctgacgatgggtgatggactggatgaaacggtaaaagtgggt
cctgtcatcaatgaaaaggcactcgagaaaattcaaagttatattgaaattggcaaagag
gaaggtgcaaatctcgtagctggcggaaatgtgctgaatgaaggtaaattcgctagcgga
cagtatttcgaaccaacgttatttgtagatgtggcatgggacagccgactagcgcaggaa
gaaattttcggtcctgttgtttcattgattacggtcagcagtctggatgaagcgatcgaa
gtaaataacagcgtagcttacggcttatccagttccattttctcgcaagacgtcaataaa
gtattccgtgcacaacgcgatctagacaccggcattgtctatattaacgcaggcacgaca
ggcgcagaaattcatctaccgtttggcggaacgaaaggtacggggaacggtcatcgagac
tctggtgtggcggcattggacgtctttacggaatggaagagcatttatatcgattacagc
ggcaagttgcagcgcgcgcaaatcgatacggaatga

DBGET integrated database retrieval system