KEGG   Candidatus Solibacter usitatus: Acid_0193Help
Entry
Acid_0193         CDS       T00412                                 

Definition
(GenBank) Exo-alpha-sialidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
sus  Candidatus Solibacter usitatus
Pathway
sus00511  Other glycan degradation
sus00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sus00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    Acid_0193
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Acid_0193
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:sus02042]
    Acid_0193
Enzymes [BR:sus01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Acid_0193
Bacterial toxins [BR:sus02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Acid_0193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR_3 BNR DUF4185
Motif
Other DBs
NCBI-ProteinID: ABJ81207
UniProt: Q02CK9
LinkDB All DBs
Position
complement(245488..246564)
Genome map
AA seq 358 aa AA seqDB search
MFSRAGAVTLLACAGLMAGAEPFQTDIFRAGEGGYHSYRIPALIVSAKGTLLAFCEGRRN
SASDTGDIDVLLRRSFDGGKTWAALQKVADMGEDTVGNPTPVIERKSGAILLLLTSNPGQ
VTERQTGPRDRTVWITRSMDDGATWSAPAEITSQVKHADWTWYATGPGNGIQLRGGRLVI
PCDHNTADGARYSHVIYSDDGGTTWKIGGIAEDKTNESAIVELKSGELLFNMRSYHGKNR
RAVQRSTDGGLMWGPLNLDETLIEPVCQASMITDSKGRVWFSNPAATTRSRMTVRMSNDG
GRTWAASQVIHQGPAAYSSLAMLRGGGIGLLYELGESKPYERIAFARFEVSWVKGKMK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgttttctagagccggggcagttacactgctggcatgcgcggggctgatggccggcgcg
gagcctttccagaccgatatttttcgcgcgggcgagggcggatatcacagctatcgaatt
ccggcgctgattgtcagcgccaagggaacgctgctggcgttttgcgaggggcggcgcaat
tcggcatcggacacgggcgatatcgatgtgctgttgcggcggagtttcgacgggggcaag
acgtgggcggcgctgcagaaggtcgccgatatgggggaggacacggtcgggaaccctacg
ccggtgatcgagcggaaaagcggcgcgattctgctgctgttgaccagcaatccgggacag
gtgacggagcggcagacgggtccgcgcgaccggacggtgtggatcacgcgttctatggat
gatggcgcgacgtggagcgcgccggcggagatcacgtcgcaggtgaagcacgcggattgg
acctggtacgccacggggccgggcaacgggatccagctgcgcggcgggcggctggtgatt
ccctgtgatcacaatacggcggacggcgcacggtattcgcacgtgatctacagcgacgat
ggcggcacgacgtggaagatcggtgggatcgcggaggacaagacaaacgaatcggcgatc
gtggagttgaagagcggagaactgctgttcaatatgcggagttatcacggcaagaatcgc
cgcgctgtgcagcgcagcacggatggcggattgatgtgggggccgctgaacctggatgag
accttgatcgagccggtatgccaggcgagcatgatcacggattccaaggggcgcgtgtgg
ttctctaatcccgcggctacgacacgttcgcggatgacggtgcggatgagcaacgatgga
gggcgcacgtgggcagcgagccaggtgatccaccaagggccggcggcatactcctcgctg
gcgatgttgcgcgggggcgggatcgggctgctgtacgagttgggagagtccaagccttac
gagcggatcgcgttcgcgcggttcgaggtgagctgggtaaaagggaaaatgaaatga

DBGET integrated database retrieval system