KEGG   Candidatus Solibacter usitatus: Acid_2799Help
Entry
Acid_2799         CDS       T00412                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sus  Candidatus Solibacter usitatus
Pathway
sus00473  D-Alanine metabolism
sus00550  Peptidoglycan biosynthesis
sus01100  Metabolic pathways
sus01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sus00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Acid_2799
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Acid_2799
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Acid_2799
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sus01011]
    Acid_2799
Enzymes [BR:sus01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Acid_2799
Peptidoglycan biosynthesis and degradation proteins [BR:sus01011]
 Precursor biosynthesis
  Amino acid ligase
   Acid_2799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 GARS_A RimK Ins134_P3_kin
Motif
Other DBs
NCBI-ProteinID: ABJ83785
UniProt: Q023Q5
LinkDB All DBs
Position
complement(3546881..3547858)
Genome map
AA seq 325 aa AA seqDB search
MKLRVAVIYGGRTGEHEVSVRSAKSILAGLDCEKYETIEYFIDQNGKWSPGPILPEPGAH
ANIDVVFPVLHGTFGEDGTVQGLLELADLPYVGAGVLGSAVSMDKEMMKRVCKERMLPIV
DYVTVTRQTPSIVDACRRLPFPMFVKPANLGSSVGISKAHDEQELEAAFSLAKQYDRKII
VERGIEGRELECSVLGNEAPMASLPCEILPSREFYDYEDKYLLDMARTQVPADLPGERTD
EIRRLAVECYRAVECEGMARVDFFLEHGTNRLYINEINTIPGFTSISMYPKMWEHSGIPF
CTLLDQLIEFALDRHRQKQVTRFAR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacgagtagccgtaatatacggcggccgcaccggcgaacatgaagtgtccgtg
cgttccgccaagtcaatcctcgccggactcgactgcgagaagtacgaaacgatcgaatac
tttatcgaccagaacggcaagtggagccctggccccatcctgcccgaacccggcgctcac
gccaacatcgatgtcgtcttccccgtcctccatggcactttcggcgaggatggcaccgtg
cagggactgctcgagctcgccgacctgccctacgtcggcgccggagtcctcggctccgcc
gtctcaatggataaggagatgatgaagcgtgtctgcaaggaacgcatgttgccaatcgtc
gattatgtgaccgttacacgtcagacacccagcatcgttgatgcctgccgccgcctcccg
ttccccatgttcgttaagcccgctaatctcggctcctcggtcggcatttccaaggcccac
gacgaacaggagctcgaggctgccttctccctcgccaaacagtacgaccgcaagatcatc
gttgagcgcggcatcgagggccgcgagctcgaatgctccgtcctcggaaatgaagccccc
atggcttccctgccctgcgaaatcctcccctcccgtgaattctacgattacgaggataag
tacctcctcgatatggcccgcacccaggtccccgccgacctccccggcgagcgcaccgac
gaaatccgccgcctcgccgtcgaatgctaccgggccgtggaatgcgagggcatggcccgc
gtcgatttcttcctggagcacgggaccaatcgcctgtacatcaacgagatcaacaccatc
cctggcttcacttccatcagcatgtaccccaaaatgtgggagcacagcggcatccccttc
tgcaccctgctcgatcagctgatcgagttcgccctggaccgccaccgccaaaaacaggtg
acccgctttgcccggtaa

DBGET integrated database retrieval system