KEGG   Candidatus Solibacter usitatus: Acid_3583Help
Entry
Acid_3583         CDS       T00412                                 

Definition
(GenBank) TonB-dependent receptor, plug
Organism
sus  Candidatus Solibacter usitatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CarboxypepD_reg CarbopepD_reg_2 SdrD_B TonB_dep_Rec
Motif
Other DBs
NCBI-ProteinID: ABJ84555
UniProt: Q020T4
LinkDB All DBs
Position
complement(4535797..4539312)
Genome map
AA seq 1171 aa AA seqDB search
MKGTTLKSVQTILAAALLAAAGFAQTQTARLVGTVHDSTGAVVPNAKVAAMNLGTKQTSE
AITNANGDYVMPALQPGTYSLTVEAGGFRKARIDGIDLAAASNVSQAITLEVGQLTEVVE
VTANTVNVQTTDSQVANSVTIKDIETLPQLARTPITLAIFQPGVQVNPQANGSSSGADYS
FAHVNGLRQGSNNNSLDGIDVNDSVAPRIGLSLTANNTDSVEEARVITDGGKAEYGRSAG
AQVQLVTRSGTNQFHGNAFDYLRNRDLNANDFFNNAAGVPIPVLIQNTYGGSFGGPIKHN
KLFFFGNYQGIRTHAQGVQNTLVPTATAQQGIFQWNTAAGVQQYNILNADPLHKGIDPTV
AALLKLYPAPNNNNCSNADGLNSSCYSFNFPNGSLSDQFTIKMDYNLNDRMHIFERTSWQ
RNSSIDSLNGAQNVIPGQDPGTQGGKRWGVAGGWDWTISSTMVNEFRYGHQSASTNFNRP
EREAGPMVSFNTWTTPLLTAFPQGRNSPVDEYTDNLTKIHGSHTFKFGGQLRFTKQYGFN
DAGIYPNVSLSTANGNILNSSLIPAGLSSTQLTSFQGMYNDLLGRISSVTETYYSNLTTF
QAAGTPRVRNFVFHEYGFFAQDDWKVRHNLTLNIGLRWEFYPVPYEANGQQGILSPANVF
NTAGTADNITVQPSTKWWNNNWKDFAPRFGFAWDPFSDGKTSIRGGYGIFNDRVVGAATS
SVDGATPGFSQAVTLFPNSTTGSDVRIGTAPPLPVQPGSPALTPAATRQTALDLMSPNLK
TGYVQQWNFNIQRQIAKNTILDVGYVANRGVKLFFQTNLDQSHIYDNGFLTAFNQIAGNL
TNLSAVPVNNPIASVFGSASAAVSAIGSSVFSTGQVGTAANTIDVNNFSRYAAAGIPQNY
LRRFPQFSTVLLGNNDGRSEYNSLQVRLQRQFGALRVGANYTWSKSIDNDLSTATGGEGN
GFAAPLDSFNEALDRGRSNFDIPHAFTMTSQYTLPIGKGHAFGGNMPGWANALVGGWDLG
SLWIWESGSPFTVSSGRATGPSTANTWADYTGSRNIGSVMTNNNGIGPGVYYFTPAQIAS
FSEPAAGSIGNSGRNTFRGPQFFNLDASLVKRFQVMEHKSITFRAEAYNLLNRVDFANPG
VNLGGNASAFGKISAVVNNPRIVQMALRFDF
NT seq 3516 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtacaacgctcaaatccgtacaaactatccttgccgccgccctcctcgcggcg
gcgggctttgcgcaaacgcaaacggctcgcttagtaggaaccgtgcacgattccaccggc
gcggtagtgcccaacgccaaagttgcagcgatgaacctggggaccaagcagaccagcgag
gccatcaccaacgccaacggagattatgtgatgccggcattgcagcccggcacttactcg
ctgacggtggaagcgggcgggttccgcaaggcacgcatcgacggtatcgatctggccgcg
gcgtcgaatgtgtcgcaggcgatcacgctggaggtcggccaacttaccgaggtggtcgag
gtgaccgcgaacacggtgaatgtgcagaccaccgattcgcaggtggcgaactccgtaacc
atcaaagatatcgagaccctgccgcaattggcgcgtacgccgattaccctggcgatcttt
cagcccggcgtgcaggtgaatccgcaggccaacggctcctcgagcggcgcggattatagc
ttcgcgcacgtcaacggactgcgccagggcagcaacaacaacagcctggacggcatcgat
gtgaacgattcggtggcgccgcgcatcggcctttcgctgaccgcgaacaacaccgattcg
gtggaagaggcccgtgtaatcaccgatggcggcaaggccgagtatggccgtagcgccggc
gcccaggttcaactggttacgcgtagcggcaccaaccagttccatggcaacgccttcgac
tatctccgcaatcgcgacctcaatgcgaatgacttcttcaataacgccgcgggcgttccg
attccggtgctgatccagaatacgtacggcggttctttcggcggaccgatcaagcacaac
aagcttttcttcttcggaaattaccagggaatccgtacgcacgcgcagggcgtgcagaat
acgctggtccccaccgcgacggcgcaacagggcatcttccaatggaacaccgcggcgggc
gtgcagcagtacaacatcctcaatgccgatccgctgcacaagggaatcgaccccacggtg
gcggcgctcctgaaactttaccccgcgcccaacaataacaattgcagcaacgccgacggc
ttgaactcttcctgctacagcttcaacttccccaatggcagtctttccgaccagttcacc
atcaagatggactacaacctcaacgacaggatgcacattttcgagcgcaccagctggcag
cgcaactcgtcgatcgattcgctcaacggcgcgcagaatgtgattcccgggcaggacccc
ggcacgcagggcggcaagcgctggggcgtggcgggaggctgggactggaccatttcctcg
accatggtcaacgagtttcgttatggccatcagagcgcgtccacgaacttcaaccgtccg
gagcgcgaagccggcccgatggtcagcttcaacacctggaccacgccgctgctcaccgcg
tttccccagggccgcaactctccggtggacgagtacaccgataacctcaccaagatccac
ggcagccacaccttcaaattcggcggccagctgcggttcacgaaacagtacggcttcaac
gacgcgggcatctatccgaacgtctcgctgagcacggcgaacggcaacattctcaattcc
agcctgattcccgccggcctaagctccacgcagctcaccagcttccagggcatgtacaac
gacctgttgggccgcatctcttcggtaacggaaacctattacagcaacctgaccacgttc
caggccgcgggcacgccgcgcgtgcgcaactttgtgttccacgaatacggcttcttcgcg
caagacgattggaaggtgcgccacaacctgacgctgaatatcgggctgcgctgggaattt
tacccggtgccctacgaggcgaacggacagcagggaattctttcacccgccaatgtgttc
aacacggcggggacggccgacaacattacggttcagccttccaccaaatggtggaacaac
aactggaaagatttcgcgccgcgcttcggcttcgcgtgggatccgttcagcgatggcaag
acgtcgatccgcggcggttacgggatcttcaacgatcgcgtggtgggcgccgcgaccagt
tccgtggatggcgcgactcccgggttctcacaggccgtgacgctcttcccgaactcgacc
acgggcagcgacgtgcgcatcggaacggcgcctccactgccggtacagccgggcagcccc
gcactcactccggccgccactcgccagacggcgctcgacctgatgagcccgaatctcaag
accgggtacgtccagcagtggaactttaacatccagcggcagatcgccaagaacacgatt
ctggatgtcgggtacgtcgccaatcgcggcgtcaagctgttcttccagacgaacctggat
caatcgcacatttatgacaacggcttcctcaccgcattcaatcagattgccggcaacctg
accaacctgagtgcggtgccggtcaacaatccgatcgcttcagtcttcggttcggccagc
gccgcagtttcggcgattggttcgagcgtgttctccacgggtcaggttggcacggcggcg
aacaccatcgacgtcaacaatttcagcaggtatgcggccgccggaattccgcagaattat
ctgcgccggttcccgcagttcagcacagtgctgctcggaaacaacgatggacgcagcgag
tacaactctctgcaggttcgcctgcagcggcagttcggcgcgctgcgcgtcggcgcgaac
tacacctggagcaagtcgattgataacgacctttcgacggctacgggcggagaaggcaac
ggctttgcggcgccgctcgacagcttcaatgaagcccttgaccgcggccgctccaacttc
gatattccgcatgctttcacgatgacctcgcagtacacgctgcctatcggcaagggccac
gcatttggcgggaatatgccgggttgggccaacgcgctggtgggtggttgggatctgggc
agcctgtggatttgggagagtggttcgcccttcacggtcagctccggacgcgccactggg
ccgagcacggccaacacatgggccgactatacaggctcgcgcaacatcggcagcgtgatg
accaataacaacggcattggaccgggcgtctactacttcacgcccgcccagatcgccagc
ttcagcgaacccgccgcgggaagcatcggcaactcgggacgcaataccttccggggaccg
caattcttcaacctcgatgcttcgctggtgaagcgcttccaggtgatggagcacaagtcc
atcacgttccgcgcggaggcgtacaacctgctgaacagggtggacttcgccaatccgggc
gtcaacctgggcggcaatgccagcgcgttcggcaaaatcagcgcggtggtcaacaatccg
cgaatcgtacagatggcgctgcgtttcgatttctag

DBGET integrated database retrieval system