KEGG   Candidatus Solibacter usitatus: Acid_5520Help
Entry
Acid_5520         CDS       T00412                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sus  Candidatus Solibacter usitatus
Pathway
sus00564  Glycerophospholipid metabolism
sus01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sus00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Acid_5520
Enzymes [BR:sus01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Acid_5520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like FAD_binding_3 NAD_binding_8 Pyr_redox_2 GIDA Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ABJ86467
UniProt: Q01V48
LinkDB All DBs
Position
6921786..6923315
Genome map
AA seq 509 aa AA seqDB search
MYLRLREHNGPWDMIVIGGGATGAGVAVDASTRGYSVLLLEQSDFGKGTSSRSTKLVHGG
VRYLEQGNLSLVMEALKERGLLLRNAPHLVRNLGFVVPNYDWWQAPFYGVGLKVYDLLAG
KYGFGSSRILSREETLARLPTIRAEDLRGGVIYFDGQFDDARLLIHLLATAFDHGASLFN
HTRVVAAACDGVRVRDEETGEEFDAAARVVINATGAFSDSVRRMADPTAAPIIAPSQGIH
LVFDRSFLPGDNAIMVPHTSDGRVMFAIPWHGHTVVGTTDTPVPQASLEPVAMEQEIDFI
LQTAALYLAKPPFRADVLSVFAGIRPLVKQGDAGRTASLSRDHTIIIEDSGIVTIAGGKW
TTYRRMAEDCVNQAATLGGLEERPCVTADLPVHGSHRAADAFGALSVYGSDAPAVRELSG
DRLHPALPYTSGEVLWAVRHEMALTVEDVLARRTRALFLNARAAVQMAPQVAALMARELG
RDQQWIATQLESFRAVAQHYLIGPASLPD
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtaccttcggctccgcgagcacaacggcccgtgggacatgatcgtcatcggaggcggc
gctaccggcgccggcgtcgccgtggacgcatccacccgcggctatagcgtcctcctcctc
gagcagagcgatttcggtaagggcacctccagccgcagtaccaagctcgtgcacggcggc
gtccgttatctggaacagggcaatctctcgctcgttatggaggccctcaaggagcgcgga
ctgctgctccgcaacgcgccccacctggtccgcaacctcggcttcgtcgtccccaattac
gactggtggcaggcgcccttctacggagtcggcctcaaggtctacgacctgctggctggg
aaatacggcttcggcagttcgcgcattctctcgcgcgaggagaccctggcgcgcctcccc
accatccgcgccgaagatctgcgcggcggcgtcatctacttcgacggccagtttgacgac
gcgcgcctcctcattcatctgcttgccactgccttcgaccacggcgcaagtctcttcaat
cacacgcgcgtggtcgctgccgcctgcgatggcgtccgcgtgcgcgacgaagaaaccggc
gaggagttcgatgccgccgcgcgcgtcgtgatcaatgccaccggcgccttcagcgattcc
gtccgccgcatggccgaccccacggccgccccaatcatcgctcccagccagggcatccac
ctggtcttcgaccgctcgtttctccccggcgacaacgccatcatggtgccgcacaccagc
gatggccgcgtcatgttcgccattccctggcacggccataccgtggtcggcactaccgac
accccggtgccgcaagcctcgctcgaaccagtcgccatggagcaggagatcgacttcatc
ctgcaaacggccgcgctctatctggccaagccgcccttccgcgccgacgtcctcagcgtc
ttcgccggcatccgtccgctcgtcaaacagggtgacgccggacgtaccgcgtcgctatcc
cgcgaccacaccatcatcatcgaagactccggcatcgtcactatcgccggcggcaagtgg
accacctatcgccgcatggccgaggattgcgtcaatcaggctgccaccctcggcggcctc
gaagaacgcccctgcgtcaccgccgacctgcccgtccacggcagccatcgcgcggccgac
gccttcggggcgctctcggtctatggctccgacgcccccgccgtgcgcgagttgtccggc
gaccgtcttcaccccgcattgccgtataccagtggtgaagttctctgggccgtccgccac
gaaatggcgctcaccgtggaagacgtgctcgcccgccgcacacgcgcgctcttcctcaac
gcccgcgccgccgttcaaatggctccccaggtcgccgctctgatggcccgcgaactgggc
cgcgaccagcagtggatcgccacccaactcgagtcttttcgcgccgtcgcacagcattat
ctgatcgggcccgctagtcttccggactag

DBGET integrated database retrieval system