KEGG   Candidatus Solibacter usitatus: Acid_7535Help
Entry
Acid_7535         CDS       T00412                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
sus  Candidatus Solibacter usitatus
Pathway
sus00040  Pentose and glucuronate interconversions
sus00051  Fructose and mannose metabolism
sus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Acid_7535
   00051 Fructose and mannose metabolism
    Acid_7535
Enzymes [BR:sus01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     Acid_7535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ABJ88443
UniProt: Q01PH7
LinkDB All DBs
Position
9442799..9443830
Genome map
AA seq 343 aa AA seqDB search
MNALLLTQYMHLEMVEMPVPAIGADDVLVRVRACGICGSDVHGLDGKTGRRIPPLVMGHE
AAGEVVETGANVTDLRPGDRVTFDSTVYCGRCFHCTRGEVNLCDNREVLGVSPGPYRRHG
AFAEYVSVPRRIMYRLPDSLSYEQAALIEAVSVAVHAVNLTPVRLGDSAVVVGSGMIGLL
AMQAAKHAGCTRVIAVDPDEGRLRLAIGAGATDAINPKSTDAAAAIRELTEGRGADLAIE
CVGATDPIRTAIAGVRKGGAVTLVGNVAPEIEFPLQSVVTRQIRLQGSCASNGEYPACID
MMARGAIRVDELITAVAPLEEGPSWFDRLYRHEPHLMKVILRP
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacttcttctcacgcaatacatgcacctggaaatggtggagatgccggtcccg
gcgattggagccgacgacgtgctggtccgcgtccgcgcctgcggcatctgcggcagcgac
gtccacgggctggacggcaagacgggccggcgcattccgcccctggtaatgggccacgag
gccgcgggcgaagttgtggaaaccggcgccaacgtgaccgacctgcgcccgggagaccgg
gtcacgttcgattccaccgtgtattgcgggcgctgcttccactgcacgcgaggcgaagtg
aacctctgcgataaccgcgaagtgctgggcgtttcgcccggaccctaccgccgccacggg
gccttcgcggagtacgtctcggtgccgcggcggatcatgtaccggctgccggatagctta
agttacgagcaggcggcgctgatcgaggccgtctccgtcgcagtgcacgccgtaaacctg
acgccggtgcggctgggcgattccgcggtggtagtcggcagcggcatgatcggcttgctg
gcgatgcaggcggcgaagcatgcgggatgcacgcgcgtgatcgcggtggatcccgacgaa
gggcgattgagactcgcgattggtgcgggtgcgaccgatgcgatcaatcccaaatccacc
gacgccgcggcggcaatccgcgagttgaccgaaggccgcggcgctgatctcgcgatcgag
tgcgtgggcgccaccgacccgatccggacggcgatcgccggagtgcggaagggcggcgcg
gtgactctggtggggaacgtggcgccggaaatcgagttcccgctgcaatccgtggtgacg
cggcagatccgcttgcagggatcgtgcgcctccaacggcgaatatccggcgtgcatcgac
atgatggcgcgcggcgcgatccgggtggatgagttgatcaccgctgtggcgccgctcgaa
gaaggcccttcgtggttcgaccgtctctaccgtcacgagccgcatttgatgaaggtgatc
ctgcgtccgtaa

DBGET integrated database retrieval system