KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_00158Help
Entry
SAT0131_00158     CDS       T01888                                 

Definition
(GenBank) Putative aldehyde dehydrogenase AldA
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
Pathway
sut00010  Glycolysis / Gluconeogenesis
sut00053  Ascorbate and aldarate metabolism
sut00071  Fatty acid degradation
sut00280  Valine, leucine and isoleucine degradation
sut00310  Lysine degradation
sut00330  Arginine and proline metabolism
sut00340  Histidine metabolism
sut00380  Tryptophan metabolism
sut00410  beta-Alanine metabolism
sut00561  Glycerolipid metabolism
sut00620  Pyruvate metabolism
sut00625  Chloroalkane and chloroalkene degradation
sut01100  Metabolic pathways
sut01110  Biosynthesis of secondary metabolites
sut01120  Microbial metabolism in diverse environments
sut01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sut00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAT0131_00158
   00053 Ascorbate and aldarate metabolism
    SAT0131_00158
   00620 Pyruvate metabolism
    SAT0131_00158
  Lipid metabolism
   00071 Fatty acid degradation
    SAT0131_00158
   00561 Glycerolipid metabolism
    SAT0131_00158
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAT0131_00158
   00310 Lysine degradation
    SAT0131_00158
   00330 Arginine and proline metabolism
    SAT0131_00158
   00340 Histidine metabolism
    SAT0131_00158
   00380 Tryptophan metabolism
    SAT0131_00158
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAT0131_00158
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAT0131_00158
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAT0131_00158
Enzymes [BR:sut01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SAT0131_00158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AEB87278
LinkDB All DBs
Position
161231..162718
Genome map
AA seq 495 aa AA seqDB search
MAVNVRDYIAENYGLFINGEFVKGSSDETIEVTNPATGETLSHITRAKDKDVDHAVKVAQ
EAFESWSLTSKSERAQMLRDIGDKLMAQKDKIAMIETLNNGKPIRETTAIDIPFAARHFH
YFASVIETEEGTVNDIDKDTMSIVRHEPIGVVGAVVAWNFPMLLAAWKIAPAIAAGNTIV
IQPSSSTPLSLLEVAKIFQEVLPNGVVNILTGKGSESGNAIFNHDGVDKLSFTGSTDVGY
QVAEAAAKHLVPATLELGGKSANIILDDANLDLAVEGIQLGILFNQGEVCSAGSRLLVHE
KIYDQLVPRLQEAFSNIKVGDPQDEATQMGSQTGKDQLDKIQSYIDAAKESDAQILAGGH
RLTENGLDKGFFFEPTLIAVPDNHHKLAQEEIFGPVLTVIKVKDDQEAIDIANDSEYGLA
GGVFSQNITRALNIAKAVRTGRIWINTYNQVPEGAPFGGYKKSGIGRETYKGALSNYQQV
KNIYIDTSNALKGLY
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaaacgttcgagattatatagcagagaattatggtttatttatcaatggggaa
tttgttaaaggtagcagtgacgagacaatcgaagtgactaatccagcaactggagaaaca
ctatcacatattacaagagcaaaagataaagatgtcgatcatgcagtcaaagtggcgcaa
gaggcatttgaatcatggtcattaacttctaaatcagaacgtgcacaaatgttgcgtgat
attggtgataaattaatggcacaaaaagataaaattgcaatgattgaaacattaaataat
ggtaaaccgattcgtgagacaacagcaattgatattccatttgctgcaagacatttccat
tatttcgcaagtgttattgaaacagaagaaggtacagtgaatgatatcgataaagacaca
atgagtatcgtacgacatgagccgattggcgtcgtaggtgctgttgttgcttggaacttc
ccaatgctattagctgcatggaagattgcgccagccattgctgcaggtaatacaattgtg
attcaaccttcgtcttcaacaccattaagtttattggaagttgctaaaattttccaagag
gtattacctaatggtgttgtcaatatactaacgggtaaaggttcagaatcaggtaatgca
attttcaatcatgatggggtagataaattatcatttacgggctcaactgatgtaggttat
caagttgccgaagctgcagcgaaacatctagtacctgctactttagagcttggtggtaaa
agcgccaatatcatattagatgatgctaatttagaccttgcagttgaaggtattcagtta
ggtattttattcaaccaaggtgaagtatgtagtgcaggttctcgattattagttcatgaa
aaaatttatgatcaattggtgccacgtttacaagaggcattttcaaatattaaagttgga
gatccacaagatgaagctacacaaatgggtagtcaaactggtaaggatcaattagataaa
attcaatcatatattgatgcagcaaaagaatcagatgcacaaattttagcaggtggtcat
cgtttaactgaaaatgggttagataaaggattcttctttgaaccaacgttaattgctgtg
ccagataatcatcataaattagcgcaagaagaaatatttggaccagttttaacagtgatt
aaagtgaaggatgatcaagaagcaattgatatagctaatgattcagagtatggtttagct
ggcggcgtattttctcaaaatatcacacgtgcattaaatattgctaaagctgttcgtaca
ggacgtatttggattaacacttacaaccaagtaccagaaggcgcaccatttggtggttat
aaaaaatcaggtatcggtcgagaaacttataaaggtgcgttaagtaactatcaacaagtt
aaaaatatttatattgatacaagcaatgctttaaaaggtttgtactag

DBGET integrated database retrieval system