KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_00210Help
Entry
SAT0131_00210     CDS       T01888                                 

Definition
(GenBank) Periplasmic iron binding protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
Pathway
sut02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sut00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SAT0131_00210
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sut02000]
    SAT0131_00210
Transporters [BR:sut02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter
    SAT0131_00210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_11 SBP_bac_6 SBP_bac_8 SBP_bac_1 CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: AEB87325
LinkDB All DBs
Position
complement(225647..226039)
Genome map
AA seq 130 aa AA seqDB search
MQLSKTSKVIEDVAKGKYYAGLSYEQDARTWKNKGYPVSIVYPIEGTMLNVDGIALVKNA
HPHPKRKKLVQYLTSRSVQQRLVAEFDAKSIRKDVSEQSDQSIENLKNIPLIPKSKLPDI
PHHKFLEMIQ
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgcaactgtcaaagacgtctaaagtcattgaagatgttgcaaaaggtaaatattatgca
ggtctaagctacgaacaagatgcacgcacatggaaaaacaaaggttatcctgtatcaatc
gtttatccaattgaaggaacaatgttaaatgttgatggtattgctttagttaaaaatgca
caccctcatcctaagcgtaaaaagttagtgcaatatttaacaagccgctcagtacaacaa
cgattagttgcagagttcgatgccaagtcaattcgaaaagatgttagtgaacaaagcgat
cagtctatcgaaaatcttaagaacatacctttaataccgaaatctaaattaccggacatt
ccgcatcataaatttttggagatgattcaatga

DBGET integrated database retrieval system