KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_00239Help
Entry
SAT0131_00239     CDS       T01888                                 

Definition
(GenBank) L-iditol 2-dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
Pathway
sut00040  Pentose and glucuronate interconversions
sut00051  Fructose and mannose metabolism
sut01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SAT0131_00239
   00051 Fructose and mannose metabolism
    SAT0131_00239
Enzymes [BR:sut01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     SAT0131_00239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 AdoHcyase_NAD NAD_binding_3 UDPG_MGDP_dh_N TrkA_N adh_short ADH_N_2 3HCDH_N 2-Hacid_dh_C adh_short_C2 CHASE4 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AEB87352
LinkDB All DBs
Position
259286..260341
Genome map
AA seq 351 aa AA seqDB search
MKALVKTREGHGNLELLDKEVATPLDDKVKIKVHYAGICGTDIHTYEGHYKVNFPVTLGH
EFSGEIVEVGADVKDFKVGDRVTSETTFYVCNECEYCESKDYNLCNHRKGIGTQVDGAFT
NYVIAREESLHHIPDEVSYQSAAMTEPLACAHHGVSKIQVNSGDVAVVMGSGPIGLLVAQ
VLKSKGATVVVTGLDNDKVRLDKAEALHMDYVVNLQQTDLKTYINGITDGYGADVVVECS
GAVPAARQGLDILRKKGFYSQIGIFKDAEITFDMEKVIQKEITVVGSRSQKPADWEPSLQ
LMADGLVNAEALVTKIYDISKWDEAYQHLKSGEGIKALLKPLDLDENEGEN
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagctttagtaaaaacaagagaaggacatggcaacttagaacttcttgataaagaa
gttgcaacaccgctagatgataaagtaaagattaaagtacattatgcaggaatttgtggc
acagatattcatacttatgaaggtcattataaagttaattttccagtgacattaggtcat
gaattttctggtgaaatcgttgaagttggagcagacgttaaagattttaaagttggtgac
cgtgtcacttctgaaacgacattctatgtttgtaatgagtgtgaatactgtgaatcaaaa
gactataatttatgcaaccatcgaaaaggtattggaacacaagttgatggcgcatttact
aattatgtcattgcacgtgaagaaagtttgcatcatattccagacgaagtgtcgtatcag
tctgcagctatgacagaaccattagcatgtgcacatcatggcgtttctaagattcaagtc
aattcaggcgatgtagcagttgtaatgggatctgggccaatcggattacttgtagcacaa
gtgttgaaaagtaaaggcgcaactgttgtggtaactggattggacaatgacaaagtcaga
ttagataaagcagaagcattgcacatggattatgtagtcaatttacaacaaacagactta
aaaacgtatatcaatggaattacagacggatacggtgcagatgttgttgttgaatgttca
ggtgcagttccagcagcacgacaaggtttggatattttacgcaaaaaaggtttctacagt
caaataggtatttttaaggatgctgaaattacatttgatatggaaaaagtgattcaaaaa
gaaataacagttgttggtagtagaagtcaaaagccggcagattgggaaccttcattgcaa
cttatggcggatggtttagtaaatgctgaagctttggtgacaaaaatatatgatatttcg
aaatgggacgaggcgtatcaacatttaaaatctggcgaaggtattaaagcattacttaag
ccgctcgatttagatgaaaatgaaggagagaattaa

DBGET integrated database retrieval system