KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_00279Help
Entry
SAT0131_00279     CDS       T01888                                 

Definition
(GenBank) Protein esaA
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3149
Motif
Other DBs
NCBI-ProteinID: AEB87389
LinkDB All DBs
Position
299915..302944
Genome map
AA seq 1009 aa AA seqDB search
MKKKNWIYALIVTLIIIIAIVSMIFFVQTKYGDQSEKGSQSVSNKNNKIHIAIVNEDQPT
TYNGKKVELGQAFIKRLANEKNYKFETVTRNVAESGLKNGGYQVMIVIPENFSKLAMQLD
AKTPSKISLQYKTAVGQKEEVAKNTEKVVSNVLNDFNKNLVEIYLTSIIDNLHNAQKNVG
AIMTREHGVNSKFSNYLLNPINDFPELFTDTLVNSISANKDITKWFQTYNKSLLSANSDT
FRVNTDYNVSTLIEKQNSLFDEHNTAMDKMLQDYKSQKDSVELDNYINALKQMDSQIDQQ
SSMQDTGKEEYKQTVKENLDKLREIIQSQESPFSKGMIEDYRKQLTESLQDELANNKDLQ
DALNSIKMNNAQFAENLEKQLHDDIVKEPDSDTTFIYNMSKQDFIAAGLNEDEANKYEAI
VKEAKRYKNEYNLKKPLAEHINLTDYDNQVAQDTSSLINDGVKVQRTETIKSNDINQLTV
ATDPHFNFEGDIKINGKKYDIKDQSVQLDTSNKEYKVEVNGVAKLKKDAEKDFLKDKTMH
LQLLFGQANRQDEPNDKKATSVVDVTLNHNLDGRLSKDALSQQLSALSRFDAHYKMYTDT
KGREDKPFDNKRLIDMMVDQVINDMESFKDDKVAVLHQIDSMEENSDKLIDDILNNKKNT
TKNKEDISKLIDQLENVKKTFAEEPQEPKIDKGKNDEFNTMSSNLDKEISRISEKSTQLL
SDTQESKTIADSVSGQLNQLDNNVNKLHATGRALGVRANDLNRQMAKNDKDNELFAKEFK
KVLQNSKDGDRQNQALKAFMSNPVQKKNLENVLANNGNTDVISPTLFVLLMYLLSMITAY
IFYSYERAKGQMNFIKDDYSSKNNLWNNAITSGVIGATGLVEGLIVGLIAMNKFHVLAGY
RAKFILMVILTMMVFVLINTYLLRQVKSIGMFLMIAALGLYFVAMNNLKAAGQGVTNKIS
PLSYIDNMFFNYLNAEHPIGLALVILTVLVIIGFVLNMFIKHFKKERLI
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaaattggatttatgcattaattgtcactttaattattataattgccata
gttagtatgatattttttgttcaaacaaaatatggagatcaatcagaaaaaggatcccaa
agtgtaagtaataaaaataataaaatacatatcgcaattgttaacgaggatcaaccaacg
acatataacggtaaaaaggttgagctgggtcaagcatttattaaaaggttagcaaatgag
aaaaactataaatttgaaacagtaacaagaaacgttgctgagtctggtttgaaaaatggc
ggataccaagtcatgattgttatcccagaaaacttttcaaaattggcaatgcaattagac
gctaaaacaccatcgaaaatatcactacagtataaaacagctgtaggacaaaaagaagaa
gtagctaaaaacacagaaaaagttgtaagtaatgtacttaacgactttaacaaaaacttg
gtcgaaatttatttaacaagcatcattgataatttacataatgcacaaaaaaatgttggc
gctattatgacgcgtgaacatggtgtgaatagtaaattctcgaattacttattaaatcca
attaacgacttcccggaattatttacagatacgcttgtaaattcgatttctgcaaacaaa
gatattacaaaatggttccaaacatacaataaatcattactgagtgcgaattcagataca
ttcagagtgaacacagattataatgtttcgactttaattgaaaaacaaaattcattattt
gacgaacacaatacagcgatggataaaatgttacaagattataaatcgcaaaaagatagc
gtggaacttgataactatatcaatgcattaaaacagatggacagccaaattgatcaacaa
tcaagtatgcaagatacaggtaaagaagaatataaacaaactgttaaagaaaacttagat
aaattaagagaaatcattcaatcacaagagtcaccattttcaaaaggtatgattgaagac
tatcgtaagcaattaacagaatcactccaagatgagcttgcaaacaacaaagacttacaa
gatgcgctaaatagcattaaaatgaacaatgctcaattcgctgaaaacttagagaaacaa
cttcatgatgatattgtcaaagaacctgattcagatacaacatttatctataacatgtct
aaacaagactttatagctgcaggtttaaatgaggatgaagctaataaatacgaagcaatt
gtcaaagaagcaaaacgttataaaaacgaatataatttgaaaaaaccgttagcagaacac
attaatttaacagattacgataaccaagttgcgcaagacacaagtagtttgattaatgat
ggtgtgaaagtgcaacgtactgaaacgattaaaagtaatgatattaatcaattaactgtt
gcaacagatcctcattttaattttgaaggcgacattaaaattaatggtaaaaaatatgac
attaaggatcaaagtgttcaactcgatacatctaacaaggaatataaagttgaagtcaat
ggcgttgctaaattgaaaaaggatgctgagaaagatttcttaaaagataaaacaatgcat
ttacaattgttatttggacaagcaaatcgtcaagatgaaccaaatgataagaaagcaacg
agtgttgtggatgtaacattgaatcataaccttgatggtcgcttatcgaaagatgcatta
agccagcaattgagtgcattatctaggtttgatgcgcattataaaatgtacacagataca
aaaggcagagaagataaaccattcgacaacaaacgtttaattgatatgatggttgaccaa
gttatcaatgacatggaaagtttcaaagacgataaagtagctgtgttacatcaaattgat
tcaatggaagaaaactcagacaaactgattgatgacattttaaataacaaaaagaataca
acaaaaaataaagaagatatttctaagctgattgatcagttagaaaacgttaaaaagact
tttgctgaagagccacaagaaccaaaaattgataaaggcaaaaatgatgaatttaatacg
atgtcttcaaatttagataaagaaattagtagaatttctgagaaaagtacgcaattgcta
tcagatacacaagaatcaaaaacaattgcagattcagttagtggacaattaaatcaatta
gataataatgtgaataaactacatgcgacaggtcgagcattaggcgtaagagcgaatgat
ttgaaccgtcaaatggctaaaaacgataaagataatgagttattcgctaaagagtttaaa
aaagtattacaaaattctaaagatggcgacagacaaaaccaagcattaaaagcatttatg
agtaatccggttcaaaagaaaaacttagaaaatgttttagctaataatggtaatacagac
gtgatttcaccgacattattcgtattattgatgtatttactatcaatgattacagcatat
attttctatagctatgaacgtgctaaaggacaaatgaatttcatcaaagatgattatagt
agtaaaaacaatctttggaataatgcgattacgtctggtgttattggtgcaactggttta
gtagaaggattaattgtcggtttaattgcaatgaataagttccatgtattagctggctat
agagcgaaattcatcttaatggtgattttaactatgatggtcttcgtacttattaatacg
tatttactaagacaggtaaaatctatcggtatgttcttaatgattgctgcattgggtcta
tactttgtagctatgaataatttgaaagcggctggacaaggtgtgactaataaaatttca
ccattatcttatatcgataacatgttcttcaattatttaaatgcagagcatcctataggc
ttggcgctagtaatattaacagtacttgtgattattggctttgtactgaacatgtttata
aaacactttaagaaagagagattaatctaa

DBGET integrated database retrieval system