KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_02025Help
Entry
SAT0131_02025     CDS       T01888                                 

Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
Pathway
sut00970  Aminoacyl-tRNA biosynthesis
sut01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sut00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SAT0131_02025
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sut03029]
    SAT0131_02025
Enzymes [BR:sut01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SAT0131_02025
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SAT0131_02025
Mitochondrial biogenesis [BR:sut03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SAT0131_02025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey MOZART1 YqeY
Motif
Other DBs
NCBI-ProteinID: AEB88989
LinkDB All DBs
Structure
PDB: 

Position
complement(2018813..2020240)
Genome map
AA seq 475 aa AA seqDB search
MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAM
RAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITR
LHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVS
DVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGE
IGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERK
AKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELL
DTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQISDEATLLK
FVNEALDNNEQSVEDYKNGKGKAMGFLVGQIMKASKGQANPQLVNQLLKQELDKR
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcattttgaaacagttataggacttgaagttcacgtagagttaaaaacggactcaaaa
atgttttctccatcaccagcgcattttggagcagaacctaactcaaatacaaatgttatc
gacttagcatatccaggtgtcttaccagttgttaataagcgtgcagtagactgggcaatg
cgtgctgcaatggcactaaatatggaaatcgcaacagaatctaagtttgaccgtaagaac
tatttctatccagataatccaaaagcatatcaaatttctcaatttgatcaaccaattggt
gaaaatggatatatcgatatcgaagtcgacggtgaaacaaaacgaatcggtattactcgt
cttcacatggaagaagatgctggtaagtcaacacataaaggtgagtattcattagttgac
ttgaaccgtcaaggtacaccgctaattgaaatcgtatctgaaccagatattcgttcacct
aaagaagcatatgcatatttagaaaaattgcgttcaattattcaatacactggtgtatca
gacgttaagatggaagagggatctttacgttgtgatgctaacatctctttacgtccatat
ggtcaagaaaaatttggtactaaagccgaattgaaaaacttaaactcatttaactatgta
cgtaaaggtttagaatatgaagaaaaacgccaagaagaagaattgttaaatggtggagaa
atcggacaagaaacacgtcgatttgatgaatctacaggtaaaacaattttaatgcgtgtt
aaagaaggttctgatgattaccgttacttcccagagcctgacattgtacctttatatatt
gatgatgcttggaaagagcgtgttcgtcagacaattcctgaattaccagatgaacgtaaa
gctaagtatgtaaatgaattaggtttacctgcatacgatgcacacgtattaacattgact
aaagaaatgtcagatttctttgaatcaacaattgaacacggtgcagatgttaaattaaca
tctaactggttaatgggtggcgtaaacgaatatttaaataaaaatcaagtagaattatta
gatactaaattaacaccagaaaatttagcaggtatgattaaacttatcgaagacggaaca
atgagcagtaaaattgcgaagaaagtcttcccagagttagcagctaaaggtggtaatgct
aaacagattatggaagataatggcttagttcaaatttctgatgaagcaacacttctaaaa
tttgtaaatgaagcattagacaataacgaacaatcagttgaagattacaaaaatggtaaa
ggcaaagctatgggcttcttagttggtcaaattatgaaagcgtctaaaggtcaagctaat
ccacaattagtaaatcaactattaaaacaagaattagataaaagataa

DBGET integrated database retrieval system