KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_02608Help
Entry
SAT0131_02608     CDS       T01888                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
Pathway
sut00010  Glycolysis / Gluconeogenesis
sut00260  Glycine, serine and threonine metabolism
sut00680  Methane metabolism
sut01100  Metabolic pathways
sut01110  Biosynthesis of secondary metabolites
sut01120  Microbial metabolism in diverse environments
sut01130  Biosynthesis of antibiotics
sut01200  Carbon metabolism
sut01230  Biosynthesis of amino acids
Module
sut_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sut_M00002  Glycolysis, core module involving three-carbon compounds
sut_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAT0131_02608
  09102 Energy metabolism
   00680 Methane metabolism
    SAT0131_02608
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAT0131_02608
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sut04131]
    SAT0131_02608
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sut04147]
    SAT0131_02608
Enzymes [BR:sut01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SAT0131_02608
Membrane trafficking [BR:sut04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SAT0131_02608
Exosome [BR:sut04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SAT0131_02608
  Exosomal proteins of melanoma cells
   SAT0131_02608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEB89515
LinkDB All DBs
Position
complement(2538635..2539321)
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTR
ALDTTHYILTESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVK
PPAETEEQREAYLADRRYNHLDKRMMPYSESLKDTLVRVIPFWTDHISQYLLDGQTVLVS
AHGNSIRALIKYLEDVSDEDIINYEIKTGAPLVYELTDDLEVIDKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattaattttatgtcgtcatggacaaagcgagtggaatgctaaaaacttattt
actggatgggaagatgttaatttatctgaacaaggtattaatgaagcgactagagcaggt
gaaaaagtaagagaaaataacattgccatcgatgtagcttttacatcgttattaacacgt
gctttagatacaacgcattatattttaactgaatctaaacaacaatggattcctgtatat
aaaagctggcgtttaaatgaacgccactatggtggattgcaaggcttaaataaagatgat
gctagaaaagaatttggagaagaacaagtacatatttggcgtcgttcttatgatgtgaaa
ccacctgctgaaaccgaagaacaacgtgaagcttacttagctgatcgtcgatataatcat
ttagataaacgtatgatgccttattctgaaagtctgaaagatactttagttcgagtgata
ccattttggacagatcatatttcacaatatttgctagatggtcaaacggtattagtttct
gcacacggaaattcaattcgcgcattgattaaatatcttgaagatgtgtcagatgaagat
atcattaattatgaaattaaaacaggtgcaccgcttgtttatgaattaacggatgattta
gaagttatagataaatactacttataa

DBGET integrated database retrieval system