KEGG   Sutterella megalosphaeroides: SUTMEG_01790Help
Entry
SUTMEG_01790      CDS       T05697                                 

Gene name
gatA
Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
sutt  Sutterella megalosphaeroides
Pathway
sutt00970  Aminoacyl-tRNA biosynthesis
sutt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sutt00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SUTMEG_01790 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sutt03029]
    SUTMEG_01790 (gatA)
Enzymes [BR:sutt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SUTMEG_01790 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SUTMEG_01790 (gatA)
Mitochondrial biogenesis [BR:sutt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SUTMEG_01790 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase Unstab_antitox
Motif
Other DBs
NCBI-ProteinID: BBF22288
UniProt: A0A2Z6IB07
LinkDB All DBs
Position
complement(202230..203687)
Genome map
AA seq 485 aa AA seqDB search
MKDVTFSSVAELSGMLRDREVSAVELARHYLDRIEAHRDLNAFLDVRPEATLAQAEEADR
RIAAGEAGPLTGIPIAHKDIFVTREWASTAASRMLEGYMSPFDATVVAKLKEAGMVCLGK
LNCDEFAMGSGNENSAFGKVFNPWDKNAVPGGSSGGSSAAVAAGLAPIVTGTDTGGSIRE
PAAFTGVTGIKPTYGRPSRLGMIAFASSLDTAGLLAHSAADCAQVLGSMVGFDPRDSTSV
DMPAEDFTRHLGMSVKGLRIGVPRSWMREGLDPEVAASIESVLDFYRSEGAEIVDIDLRQ
AELGVPVYYVVACAEASSNLSRFDGVRYGHRAKEYTDIIDMIKRSRNEGFGPEPKRRIMI
GTYVLSHGYYDAYYLKAQKVRRLIAREFHETFKQVDVIACPVTTGTAYDFGANADPVSAY
LSDLYTVPASLAGLPGLSMPCGIHSNGRPIGIQLIGENFTEARLLGVADCWQRATDWHLR
RPSGY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgtaacgttcagctccgtggcggagctctccggcatgctccgcgaccgtgaa
gtgtcggccgtcgagcttgcccgccactacctcgatcgcatcgaagcgcatcgcgatctc
aacgcgttcctcgacgtgcgccccgaggcgacccttgctcaggccgaagaggccgaccgt
cgcatcgcggcgggcgaagccggtcccctcacgggtattccgatcgcgcacaaggacatc
ttcgtgacgcgcgaatgggcctccaccgccgcgagccgcatgctcgaaggctacatgagc
ccgttcgacgcgaccgtggtcgcgaaactcaaagaggcgggcatggtgtgcctcggcaag
ctcaactgcgacgaattcgccatgggctcgggcaacgaaaattccgccttcggcaaggtg
ttcaatccctgggacaagaatgcggttccgggcggctcctcgggcggctcttcggccgcc
gtggccgcgggcctcgctccgatcgtcaccggcaccgacacgggcggctccattcgcgaa
cccgccgcgttcacgggcgtgacgggcatcaagccgacctacggccgtccgtcgcgcctc
gggatgatcgcctttgcgtcgtctctggatacggcgggcctcctggcccactccgccgcc
gactgcgctcaggtgctcggctccatggttgggttcgacccgcgcgattcgacgagcgtc
gacatgcccgccgaagactttacgcgccacctcggcatgagcgtgaaggggcttcgcatc
ggcgtgccccgctcctggatgcgcgaagggctcgaccccgaagtggccgcctcgatcgaa
tccgtgctcgacttctaccgctcggaaggcgcggaaatcgtcgacatcgacctccgtcag
gctgaactcggcgtgcccgtctactacgtcgtcgcctgcgccgaagcgagctccaacctc
tcgcgcttcgacggcgtgcgttacggccatcgcgcgaaggaatacaccgacatcatcgac
atgatcaagcgctcgcgcaacgaagggttcggccccgaaccgaagcgccgcatcatgatc
ggcacgtacgtgctctcgcacggctactacgacgcctactacctgaaggctcagaaggtc
cgtcgactcatcgcccgcgaattccacgaaacgttcaagcaggtcgacgtgatcgcctgt
ccggtcacgacgggtacggcctacgacttcggcgcgaacgccgatccggtttcggcctac
ctgagcgacctctacacggtgcccgcgtccctggccggtctgcccggcctttcgatgccc
tgcggcatccattcgaacggccgtccgatcggcattcagctcatcggcgaaaacttcacc
gaagcccgcctgctcggcgttgccgactgctggcagcgtgcgaccgactggcacctgcgt
cgtccgtcgggttactga

DBGET integrated database retrieval system