KEGG   Sutterella megalosphaeroides: SUTMEG_03570Help
Entry
SUTMEG_03570      CDS       T05697                                 

Gene name
glpA
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sutt  Sutterella megalosphaeroides
Pathway
sutt00564  Glycerophospholipid metabolism
sutt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sutt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SUTMEG_03570 (glpA)
Enzymes [BR:sutt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SUTMEG_03570 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 Pyr_redox_2 HI0933_like NAD_binding_8 GIDA 3HCDH_N Thi4 Lycopene_cycl FAD_binding_3 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: BBF22466
UniProt: A0A2Z6ICV2
LinkDB All DBs
Position
393373..395007
Genome map
AA seq 544 aa AA seqDB search
MSDVKPIVREDMLAQLREDVLWDVVVIGGGATGTGIAVDAASRGLKVVLLEAQDFSAGTS
SRSTKLIHGGVRYMKNPRDWGLVREALKERRLLIQNAPHLVHSKPFILPCYKKWEREFYT
VGLGIYAAMTYGGYGIGRTSSLSREETMSRLPGVKAEGLMGGVQFYDGQFDDARLAVALM
RTAHDQGALTLNYMPVTGIEYRGGWIQSVTATDKETGEEFRIRTKMVFNAAGAWVDPIRR
MVDPEASTLVQVSRGSHILLDKSFMPGETGMLIPKTRDGRVLFAIPWHEMLLVGTTDVEQ
READFDPKVSDEEIDFMIETASGYLDKPITRADVKATFAGLRPLFNPQATGSAGGTAKVS
REHAVLPEFGNMITVTGGKWTAYRKMAEHAMTEATLRHLVAPRLCVTKTLPILNDETWDP
AALEVEAERSDAADDKVVAYALYCREFEAARTAEDVLFRRLRLGQMNEARTNELLPKVRA
AFAGEAQVEKEVAAVVAATEAAEPVEAKAEAAVEAPETVEKVEAAEVVEAVEAVEAEKDG
KAEK
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatgtgaaacccatcgtccgcgaggatatgctcgcgcagcttcgtgaagacgtt
ctctgggacgtcgttgtgatcgggggcggcgccaccggtacgggcatcgcggttgacgcc
gcgtcgcgcggcctcaaggtcgtgctcctcgaggcgcaggacttctccgcgggtacctct
tcgcgctcgacgaagctcattcacgggggcgttcgctacatgaagaacccccgcgactgg
gggctcgtgcgcgaagcgctcaaggaacgccgtctgctcatccagaacgcgccccatctc
gtgcactcgaagcccttcatcctcccctgctacaagaagtgggagcgtgagttctacacg
gtcggtctcggcatctacgcggccatgacctacggcggctacggcatcggccgaacgagc
agcctttcgcgcgaagaaaccatgtcgcgactccccggcgtgaaggccgaaggcctcatg
ggtggcgtgcagttctacgacggtcagttcgacgacgcgcgtctcgcggtggccctcatg
cgcaccgcgcacgaccagggtgcgctcaccctcaactacatgcccgtcaccggcatcgaa
taccgcggcggctggatccagtccgtcacggccaccgacaaggaaacgggcgaagaattc
cgcatccgcacgaagatggtcttcaacgccgcgggtgcctgggtcgatccgatccgccgc
atggtcgatccggaagcgtcgaccctcgtgcaggtttcgcgcggctcgcacatcctgctc
gacaagtccttcatgccgggcgaaaccggcatgctcatcccgaagacgcgcgacggccgc
gtgctctttgccattccctggcatgaaatgctcctcgtcggcacgaccgacgtcgaacag
cgcgaagccgacttcgatccgaaggtgagcgacgaagaaatcgacttcatgatcgaaacg
gcctcgggctacctcgacaagcccatcacccgcgccgacgtgaaggcgacctttgcgggt
ctgcgtccgctcttcaacccgcaggcgacgggttcggcgggcgggacggccaaggtctcg
cgcgaacacgccgtcttgcccgaattcggtaacatgatcaccgtgacgggcggcaagtgg
acggcctaccgcaagatggccgaacacgccatgacggaagcgaccctgcgtcacctcgtg
gcgccgcgcctctgcgtgacgaagactctcccgatcctcaacgacgaaacgtgggatccg
gccgcgctcgaagtcgaagccgaacgctccgacgccgcggacgacaaggtcgtcgcctac
gcgctttactgccgcgaattcgaagccgcccgtacggccgaagacgtgctcttccgtcgt
ctgcgcctcggccagatgaacgaagcccgcacgaacgaactcctgccgaaggtgcgcgcc
gcgtttgcgggcgaagcccaagtcgaaaaggaagtggccgccgtcgttgccgcgaccgaa
gccgccgagcccgtcgaagcgaaggcggaagcggccgtcgaggctcccgaaacggttgaa
aaggtcgaagccgccgaagtcgttgaggcggtcgaagcggtcgaagccgaaaaggacggg
aaggccgaaaagtaa

DBGET integrated database retrieval system