KEGG   Sutterella megalosphaeroides: SUTMEG_04850Help
Entry
SUTMEG_04850      CDS       T05697                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
sutt  Sutterella megalosphaeroides
Pathway
sutt00061  Fatty acid biosynthesis
sutt00780  Biotin metabolism
sutt01100  Metabolic pathways
sutt01130  Biosynthesis of antibiotics
sutt01212  Fatty acid metabolism
Module
sutt_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sutt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SUTMEG_04850 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SUTMEG_04850 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SUTMEG_04850 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sutt01004]
    SUTMEG_04850 (fabI)
Enzymes [BR:sutt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     SUTMEG_04850 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     SUTMEG_04850 (fabI)
Lipid biosynthesis proteins [BR:sutt01004]
 Fatty acid synthase
  Component type
   SUTMEG_04850 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase KR
Motif
Other DBs
NCBI-ProteinID: BBF22594
UniProt: A0A2Z6I878
LinkDB All DBs
Position
533508..534299
Genome map
AA seq 263 aa AA seqDB search
MGFLTGKKLLITGVISNRSIAYGIAEACRREGAELAFTYVGERFRDRVAAFAEEFGSSIC
LPMDVSSDEEIAAVAEELKNRWGGLDGVVHSIGFAPREAIAGDFLDGLSRDAFKTAMDIS
AYSFPALAKACLPLMEGRNASVLTLTYLGSERVVPNYNTMGLAKAALEASTRYLASSLGP
KGIRANAISAGPIKTLAASGIQDFSKLLHIMEETAPLGRTVTIQEVGNTAAFLLSDLASG
ITGDIIYVDAGFHAVGVGVPAGK
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcctgaccggcaagaagctgctcatcacgggcgtcatctccaaccgttccatc
gcttacggcattgccgaagcgtgccgtcgcgaaggcgcagaacttgctttcacgtacgtc
ggggaacgcttccgcgatcgcgtggcggcctttgccgaagagttcgggagctcgatttgc
ctgcccatggacgtgagcagcgatgaagaaatcgccgccgttgccgaagagctgaagaac
cgctggggcggtctcgacggcgtggtgcactcgatcggcttcgcgccccgcgaagcgatt
gcgggcgacttcctcgacggtctctctcgcgacgccttcaagacggccatggatatttcc
gcctactccttcccggctcttgcgaaagcctgccttcccctgatggaaggccgcaacgcc
tcggtgctgacgctcacctacctcggcagcgaacgcgtcgttccgaactacaacacgatg
ggtctggcgaaggccgcccttgaagcttcgacccgctacctcgcttcaagcctcggtccc
aagggcatccgcgcgaacgccatttccgccggtcccatcaaaacgctggccgcctcgggc
attcaggacttctcgaagctcctgcacatcatggaagaaacggcgccgctcggccgcacc
gtgaccatccaggaagtcggcaacacggccgccttccttctctccgatctcgcgagcggc
atcacgggcgacatcatctacgtcgatgcgggcttccacgcggtcggcgtcggcgtgccc
gccggcaagtaa

DBGET integrated database retrieval system