KEGG   Staphylococcus aureus subsp. aureus M013 (CA-MRSA): M013TW_0705Help
Entry
M013TW_0705       CDS       T01744                                 

Definition
(GenBank) LTA synthase family protein
  KO
K19005  lipoteichoic acid synthase [EC:2.7.8.20]
Organism
suu  Staphylococcus aureus subsp. aureus M013 (CA-MRSA)
Pathway
suu00561  Glycerolipid metabolism
suu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:suu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    M013TW_0705
Enzymes [BR:suu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.20  phosphatidylglycerol---membrane-oligosaccharide glycerophosphotransferase
     M013TW_0705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sulfatase DUF229 Phosphodiest DUF1501
Motif
Other DBs
NCBI-ProteinID: AEV77777
LinkDB All DBs
Structure
PDB: 

Position
764843..766783
Genome map
AA seq 646 aa AA seqDB search
MSSQKKKISLFAFFLLTVITITLKTYFSYYVDFSLGVKGLVQNLILLMNPYSLVALVLSV
FLFFKGKKAFWFMFIGGFLLTFLLYANVVYFRFFSDFLTFSTLNQVGNVESMGGAVSASF
KWYDFVYFIDTLVYLFILIFKTKWLDTKAFSKKFVPVVMAASVALFFLNLAFAETDRPEL
LTRTFDHKYLVKYLGPYNFTVYDGVKTIENNQQKALASEDDLTKVLNYTKQRQTEPNPEY
YGVAKKKNIIKIHLESFQTFLINKKVNGKEVTPFLNKLSSGKEQFTYFPNFFHQTGQGKT
SDSEFTMDNSLYGLPQGSAFSLKGDNTYQSLPAILDQKQGYKSDVMHGDYKTFWNRDQVY
KHFGIDKFYDATYYDMSDKNVVNLGLKDKIFFKDSANYQAKMKSPFYSHLITLTNHYPFT
LDEKDATIEKSNTGDATVDGYIQTARYLDEALEEYINDLKKKGLYDNSVIMIYGDHYGIS
ENHNNAMEKLLGEKITPAKFTDLNRTGFWIKIPGKSGGINNEYAGQVDVMPTILHLAGID
TKNYLMFGTDLFSKGHNQVVPFRNGDFITKDYKYVNGKIYSNKNNELITTQPADFEKNKK
QVEKDLEMSDNVLNGDLFRFYKNPDFKKVNPSKYKYETGPKANSKK
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgagttcacaaaaaaagaaaattagtctttttgcgttcttcttattaaccgtaataacg
attaccttgaagacgtatttttcttattatgttgatttttctttaggtgttaaaggttta
gtacaaaacttaatattattgatgaatccttatagtttagtagcactggttttaagtgtg
ttcctattctttaaaggcaaaaaagcattttggttcatgttcataggcggcttcttattg
acgttcctattatatgccaatgttgtgtactttagattcttctcggattttttaacgttt
agtactttaaaccaagtaggtaacgtagaatctatgggtggtgcggttagtgcatcattc
aaatggtatgactttgtttatttcattgatacgttagtttacttattcattttaatattt
aaaacaaaatggttagacacaaaagcatttagtaagaaatttgttcctgtcgtaatggcg
gcttcagtagcattattcttcttaaacttagcttttgctgaaactgacagaccagaatta
ttaacacgtacatttgaccataaatatttagtgaaatatttaggaccgtataactttaca
gtatacgatggtgttaaaactatcgaaaataatcaacaaaaagcgttagcatctgaagat
gacttaacaaaagtattaaattacacgaaacaacgtcaaacagagcctaacccagaatat
tatggggtggcaaagaagaaaaatattattaagattcatttagaaagtttccaaaccttc
ttaattaataaaaaggttaatggtaaagaagtaacaccgtttttaaacaaattatcaagt
gggaaagagcaattcacatacttccctaactttttccatcaaacaggtcaaggtaaaaca
tctgactctgaatttacaatggataacagtttatacggtttaccgcaaggttctgccttt
tcattaaaaggagataatacgtatcagtcattaccagcaattttagatcaaaagcaaggc
tacaaatctgatgtcatgcacggtgactataaaacattctggaacagagaccaagtatat
aaacactttggtatcgataaattctatgatgcaacatactatgacatgtcagataaaaac
gttgtaaacttaggcttgaaagacaaaattttctttaaagattctgctaattatcaagct
aagatgaaatcaccattctattctcatttaattacattgactaaccactatccattcaca
ttagatgaaaaggatgcaactattgagaagtcaaacacaggtgatgcaacagttgatggt
tatattcaaacagcgcgttatttagacgaagcattagaagaatatattaatgacttgaag
aaaaaaggattatatgacaattcagtgattatgatttatggtgaccactatggtatctct
gaaaaccataacaatgccatggaaaaactattaggtgaaaaaatcacaccagctaaattt
acagatttaaacagaactggtttctggattaaaatccctggtaaatctggtggtatcaat
aatgaatatgctggtcaagtcgatgtaatgccaacaattttacatttggctggtatagat
acgaagaactatttaatgttcggtactgatttattctctaaaggtcataatcaagtagtt
ccattcagaaatggtgactttataacaaaagattataaatatgttaatggtaagatttat
tctaataaaaataatgaactcataactactcaaccagctgatttcgaaaagaataaaaag
caagttgaaaaggatctcgaaatgagtgacaacgtgcttaatggtgatttgtttagattc
tacaaaaatccagacttcaaaaaggtaaatccttcgaagtataaatatgaaacaggacct
aaagcaaactctaaaaaataa

DBGET integrated database retrieval system