KEGG   Staphylococcus aureus subsp. aureus M013 (CA-MRSA): M013TW_1158Help
Entry
M013TW_1158       CDS       T01744                                 

Definition
(GenBank) Serine/threonine protein kinase PrkC, regulator of stationary phase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
suu  Staphylococcus aureus subsp. aureus M013 (CA-MRSA)
Brite
KEGG Orthology (KO) [BR:suu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:suu01001]
    M013TW_1158
Enzymes [BR:suu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     M013TW_1158
Protein kinases [BR:suu01001]
 Serine/threonine kinases: Other
  Bacterial family
   M013TW_1158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Seadorna_VP7 RIO1 Sigma_reg_N Choline_kinase Kinase-like Kdo ETRAMP Spore_permease PNPase
Motif
Other DBs
NCBI-ProteinID: AEV78216
LinkDB All DBs
Structure
PDB: 

Position
1210812..1212806
Genome map
AA seq 664 aa AA seqDB search
MIGKIINERYKIVDKLGGGGMSTVYLAEDTILNIKVAIKAIFIPPREKEETLKRFEREVH
NSSQLSHQNIVSMIDVDEEDDCYYLVMEYIEGPTLSEYIESHGPLSVDTAINFTNQILDG
IKHAHDMRIVHRDIKPQNILIDSNKTLKIFDFGIAKALSETSLTQTNHVLGTVQYFSPEQ
AKGEATDECTDIYSIGIVLYEMLVGEPPFNGETAVSIAIKHIQDSVPNVTTDVRKDIPQS
LSNVILRATEKDKANRYKTIQEMKDDLSSVLHENRANEDVYELDKMKTIAVPLKKEDLAK
HISEHKSNQPKRETTQVPIVNGPAHHQQFQKPEGMLYEPKPKKKSTRKIVLLSLIFSLLM
IALVSFVAMAMFGNKYEETPDVIGKSVKEAEQIFNKNNLKLGKISRSYSDKYPENEIIKT
TPNTGERVERGDSVDVVISKGPEKVKMPNVIGLPKEEALQKLKSLGLKDVTIEKVYNNQA
PKGYIANQSVTANTEIAIHDSNIKLYESLGIKQVYVEDFEHKSFSKAKKALEEKGFKVES
KEEYSDDIDEGDVISQSPKGKSVDEGSTISFVVSKGKKSDSSDVKTTTESVDVPYTGKND
KSQKVKVYIKDKDNDGSTEKGSFDITSDQRIDIPLRIEKGKTASYIVKVDGKTVAEKEVS
YDDI
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgataggtaaaataataaatgaacgatataaaattgtagataagcttggcggcggtggc
atgagtaccgtttatcttgcagaagatacgatacttaacattaaagttgcaattaaggcg
atttttataccacctagagaaaaagaagaaacattaaaacgttttgaacgagaagtacat
aactcatcacagctatcacatcaaaatatagtaagtatgatcgatgttgatgaagaagat
gactgttactacttagtaatggaatatattgaaggtccgactttgtctgagtatatagaa
agtcatgggccattaagtgttgacacggcgattaattttacgaatcaaatattggatggc
attaaacatgcacatgatatgcgtattgtacatagagatattaagccacaaaatatatta
attgacagcaataaaacgttgaaaatatttgattttggaattgctaaagctttaagtgag
acgtctttaactcagactaatcatgtgttaggtactgtgcagtacttttcgccagaacaa
gcaaaaggtgaggcaacggatgaatgtacagatatttattctataggtattgtgttatat
gaaatgcttgttggtgaaccaccatttaatggagaaactgcagttagcattgcgattaaa
catattcaggattctgtgccaaatgtgacaacagatgtacgtaaggatattccgcaatct
ttaagtaatgtcattttacgcgctacagaaaaagacaaagcgaatcgttacaaaacaatt
caagaaatgaaagatgatttgagtagtgttttacatgaaaatcgagcgaatgaagacgtc
tatgaactcgataaaatgaaaacgatagcggtacctttgaaaaaagaagatctagcaaag
catattagtgaacataagtcgaatcaacctaaacgtgaaacgacgcaagtacctattgta
aatgggcctgctcatcatcagcaattccaaaagccagaaggtatgttgtatgaaccaaaa
cctaaaaagaaatcaacacgaaagattgtgctcttatcactaatcttttcgttgttaatg
attgcacttgtttcttttgtggcaatggcaatgtttggtaataaatacgaagagacacct
gatgtaatcgggaaatctgtaaaagaagcagagcaaatattcaataaaaataatctgaaa
ttaggtaaaatttctagaagttatagtgataaatatcctgaaaatgaaattattaagaca
acccctaatacaggtgaacgtgttgaacgtggtgacagtgttgatgttgttatatcaaaa
ggccctgaaaaggttaaaatgccaaatgtcattggtttacctaaggaggaagccttacag
aaattaaaatcgttaggtcttaaagatgttacgattgaaaaagtatataataatcaagca
ccaaaaggatacattgcaaatcaaagtgtaaccgcaaatactgaaatcgctattcatgat
tctaatattaaactatatgaatctttaggcattaagcaagtttatgtagaagactttgaa
cataaatcctttagcaaagctaaaaaagccttagaagaaaaaggatttaaagttgaaagt
aaagaagagtatagcgacgatattgatgagggtgatgtaatttctcaatctccaaaaggg
aaatcagtagatgaggggtcaacgatttcgtttgttgtttctaaaggtaaaaaaagcgac
tcatcagatgtcaaaacgacaactgaatcggtagatgtaccatacactggtaaaaatgat
aagtcacaaaaagttaaagtttatattaaagataaagataatgacggttcaactgaaaaa
ggtagtttcgacattactagtgatcaacgtatagacattcctttaagaattgaaaaagga
aaaacagcaagttatattgttaaagtagacggtaaaactgtagctgaaaaagaagtcagc
tatgatgatatttaa

DBGET integrated database retrieval system