KEGG   Staphylococcus aureus subsp. aureus M013 (CA-MRSA): M013TW_2081Help
Entry
M013TW_2081       CDS       T01744                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
suu  Staphylococcus aureus subsp. aureus M013 (CA-MRSA)
Pathway
suu00010  Glycolysis / Gluconeogenesis
suu00053  Ascorbate and aldarate metabolism
suu00071  Fatty acid degradation
suu00280  Valine, leucine and isoleucine degradation
suu00310  Lysine degradation
suu00330  Arginine and proline metabolism
suu00340  Histidine metabolism
suu00380  Tryptophan metabolism
suu00410  beta-Alanine metabolism
suu00561  Glycerolipid metabolism
suu00620  Pyruvate metabolism
suu00625  Chloroalkane and chloroalkene degradation
suu01100  Metabolic pathways
suu01110  Biosynthesis of secondary metabolites
suu01120  Microbial metabolism in diverse environments
suu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:suu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M013TW_2081
   00053 Ascorbate and aldarate metabolism
    M013TW_2081
   00620 Pyruvate metabolism
    M013TW_2081
  09103 Lipid metabolism
   00071 Fatty acid degradation
    M013TW_2081
   00561 Glycerolipid metabolism
    M013TW_2081
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M013TW_2081
   00310 Lysine degradation
    M013TW_2081
   00330 Arginine and proline metabolism
    M013TW_2081
   00340 Histidine metabolism
    M013TW_2081
   00380 Tryptophan metabolism
    M013TW_2081
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    M013TW_2081
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    M013TW_2081
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    M013TW_2081
Enzymes [BR:suu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     M013TW_2081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEV79085
LinkDB All DBs
Structure
PDB: 

Position
complement(2142033..2143460)
Genome map
AA seq 475 aa AA seqDB search
MRDYTKQYINGEWVKSNSNETIEVINPATEEVIGKVAKGNKADVDKAVEAADNVYLEFRH
TSVKERQALLDKIVKEYENRKDDIVQAITDELGAPLSLSERVHYQMGLNHFVAARDALDN
YEFEERRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAV
ILAEIFDKVGVPKGVFNLVNGDGAGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAAKDFK
KVSLELGGKSPYIVLDDVDIKEAAKATTGKVVNNTGQVCTAGTRVLVPNKIKDAFLAELK
EQFSQVRVGNPREDGTQVGPIISKKQFDQVQNYINKGIEEGAELFYGGPGKPEGLEKGYF
ARPTIFINVDNQMTIAQEEIFGPVMSVITYNDLDEAIQIANDTKYGLAGYVIGKDKETLH
KVARSIEAGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagagactacacaaagcaatacattaatggcgaatgggtaaaaagtaatagtaatgaa
acgatagaagttataaatccagcaactgaagaagtaattgggaaagttgctaaaggtaat
aaagctgatgttgataaagccgtcgaggcggcagataatgtttatttagagttccgtcat
acatctgtgaaagaaagacaagcattattagataaaattgtaaaagaatatgaaaacaga
aaagacgatattgtacaagctattacggatgagttaggtgctcctttatcattatctgag
cgtgtccattatcaaatgggactaaaccattttgttgcagcgagagacgcattagataac
tacgaatttgaagaacgccgcggagatgatttagttgttaaagaagcaatcggtgtatct
ggcttaattacaccgtggaacttccctacaaaccaaacatcattaaaattagcggcagca
tttgcggctggtagtccagttgtacttaaaccatcagaagaaacaccatttgcagctgtt
attttagctgagatttttgataaagtcggtgttcctaaaggtgtatttaaccttgttaat
ggtgatggtgctggagttgggaatcctttatctgaacatcctaaagtacgcatgatgtca
tttacaggatcaggccctactggttctaaaattatggaaaaagctgctaaagactttaaa
aaggtatcattagagcttggtggcaaatcaccatacatcgtcctagatgacgtagatatt
aaagaagcggctaaagcaacaacaggcaaagttgttaataatactggtcaagtatgtaca
gctggtacacgtgttttagtgcctaacaaaattaaagatgcattcttagctgaattaaaa
gaacaatttagccaagtgcgtgtcggtaatccaagagaagatggtacacaagtaggccct
atcattagtaaaaaacaatttgatcaagtacaaaattatattaataaaggtattgaagaa
ggtgctgaattattttatggtggtcctggtaaaccagaaggacttgaaaaaggatacttt
gcacgtccgacaatttttattaatgtagataatcaaatgacgatagcacaagaagaaatt
tttgggccagtaatgtcggttatcacttataacgatttagatgaagcgattcaaattgca
aatgatacaaaatatggtttggcaggatatgttattggtaaggacaaagaaacattgcat
aaagtagctcgttctattgaagcaggtacagtagaaataaacgaagcaggtagaaagcca
gacttaccatttggtggctataaacaatctggtttaggtcgtgaatggggcgattatggt
attgaagagttcttagaagtgaaatctatagctggctattttaaataa

DBGET integrated database retrieval system