KEGG   Staphylococcus aureus subsp. aureus VC40: SAVC_05910Help
Entry
SAVC_05910        CDS       T01745                                 

Definition
(GenBank) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
suv  Staphylococcus aureus subsp. aureus VC40
Pathway
suv00380  Tryptophan metabolism
suv00630  Glyoxylate and dicarboxylate metabolism
suv01100  Metabolic pathways
suv01110  Biosynthesis of secondary metabolites
suv01130  Biosynthesis of antibiotics
suv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:suv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAVC_05910
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    SAVC_05910
Enzymes [BR:suv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     SAVC_05910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel
Motif
Other DBs
NCBI-ProteinID: AEZ37342
LinkDB All DBs
Position
1273689..1275206
Genome map
AA seq 505 aa AA seqDB search
MSQQDKKLTGVFGHPVSDRENSMTAGPRGPLLMQDIYFLEQMSQFDREVIPERRMHAKGS
GAFGTFTVTKDITKYTNAKIFSEIGKQTEMFARFSTVAGERGAADAERDIRGFALKFYTE
EGNWDLVGNNTPVFFFRDPKLFVSLNRAVKRDPRTNMRDAQNNWDFWTGLPEALHQVTIL
MSDRGIPKDLRHMHGFGSHTYSMYNDSGERVWVKFHFRTQQGIENLTDEEAAEIIATDRD
SSQRDLFEAIEKGDYPKWTMYIQVMTEEQAKNHKDNPFDLTKVWYHDEYPLIEVGEFELN
RNPDNYFMDVEQAAFAPTNIIPGLDFSPDKMLQGRLFSYGDAQRYRLGVNHWQIPVNQPK
GVGIENICPFSRDGQMRVVDNNQGGGTHYYPNNHGKFDSQPEYKKPPFPTDGYGYEYNQR
QDDDNYFEQPGKLFRLQSEDAKERIFTNTANAMEGVTDDVKRRHIRHCYKADPEYGKGVA
KALGIDINSIDLETENDETYENFEK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaacaagacaaaaagttaactggtgtttttgggcatccagtatcagaccgagaa
aatagtatgacagcagggcctaggggacctcttttaatgcaagatatttactttttagag
caaatgtctcaatttgatagagaagtaataccagaacgtcgaatgcatgccaaaggttct
ggtgcatttgggacatttactgtaactaaagatataacaaaatatacgaatgctaaaata
ttctctgaaataggtaagcaaaccgaaatgtttgcccgtttctctactgtagcaggagaa
cgtggtgctgctgatgcggagcgtgacattcgaggatttgcgttaaagttctacactgaa
gaagggaactgggatttagtagggaataacacaccagtattcttctttagagatccaaag
ttatttgttagtttaaatcgtgcggtgaaacgagatcctagaacaaatatgagagatgca
caaaataactgggatttctggacgggtcttccagaagcattgcaccaagtaacgatctta
atgtcagatagagggattcctaaagatttacgtcatatgcatgggttcggttctcacaca
tactctatgtataatgattctggtgaacgtgtttgggttaaattccattttagaacgcaa
caaggtattgaaaacttaactgatgaagaagctgctgaaattatagctacagatcgtgat
tcatctcaacgcgatttattcgaagccattgaaaaaggtgattatccaaaatggacaatg
tatattcaagtaatgactgaggaacaagctaaaaaccataaagataatccatttgattta
acaaaagtatggtatcacgatgagtatcctctaattgaagttggagagtttgaattaaat
agaaatccagataattactttatggatgttgaacaagctgcgtttgcaccaactaatatt
attccaggattagatttttctccagacaaaatgctgcaagggcgtttattctcatatggc
gatgcgcaaagatatcgattaggagttaatcattggcagattcctgtaaaccaacctaaa
ggtgttggtattgaaaatatttgtccttttagtagagatggtcaaatgcgcgtagttgac
aataaccaaggtggaggaacacattattatccaaataaccatggtaaatttgattctcaa
cctgaatataaaaagccaccattcccaactgatggatacggctatgaatataatcaacgt
caagatgatgataattattttgaacaaccaggtaaattgtttagattacaatcagaggac
gctaaagaaagaatttttacaaatacagcaaatgcaatggaaggcgtaacggatgatgtt
aaacgacgtcatattcgtcattgttacaaagctgacccagaatatggtaaaggtgttgca
aaagcattaggtattgatataaattctattgatcttgaaactgaaaatgatgaaacatac
gaaaactttgaaaaataa

DBGET integrated database retrieval system