KEGG   Staphylococcus aureus subsp. aureus HO 5096 0412: SAEMRSA15_01330Help
Entry
SAEMRSA15_01330   CDS       T02059                                 

Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sux  Staphylococcus aureus subsp. aureus HO 5096 0412
Pathway
sux00010  Glycolysis / Gluconeogenesis
sux00053  Ascorbate and aldarate metabolism
sux00071  Fatty acid degradation
sux00280  Valine, leucine and isoleucine degradation
sux00310  Lysine degradation
sux00330  Arginine and proline metabolism
sux00340  Histidine metabolism
sux00380  Tryptophan metabolism
sux00410  beta-Alanine metabolism
sux00561  Glycerolipid metabolism
sux00620  Pyruvate metabolism
sux00625  Chloroalkane and chloroalkene degradation
sux01100  Metabolic pathways
sux01110  Biosynthesis of secondary metabolites
sux01120  Microbial metabolism in diverse environments
sux01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sux00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAEMRSA15_01330
   00053 Ascorbate and aldarate metabolism
    SAEMRSA15_01330
   00620 Pyruvate metabolism
    SAEMRSA15_01330
  Lipid metabolism
   00071 Fatty acid degradation
    SAEMRSA15_01330
   00561 Glycerolipid metabolism
    SAEMRSA15_01330
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAEMRSA15_01330
   00310 Lysine degradation
    SAEMRSA15_01330
   00330 Arginine and proline metabolism
    SAEMRSA15_01330
   00340 Histidine metabolism
    SAEMRSA15_01330
   00380 Tryptophan metabolism
    SAEMRSA15_01330
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAEMRSA15_01330
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAEMRSA15_01330
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAEMRSA15_01330
Enzymes [BR:sux01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SAEMRSA15_01330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: CCG14851
LinkDB All DBs
Position
160128..161615
Genome map
AA seq 495 aa AA seqDB search
MAVNVRDYIAENYGLFINGEFVKGSSDETIEVTNPATGETLSHITRAKDKDVDYAVEVAQ
EAFESWSLTSKSERAQMLRDICDKLMAQKDKIAMIETLNNGKPIRETTAIDIPFAARHFH
YFASVIETEEGTVNDIDKDTMSIVRHEPIGVVGAVVAWNFPMLLAAWKIAPAIAAGNTIV
IQPSSSTPLSLLEVAKIFQEVLPKGVVNILTGKGSESGNAIFNHDGVDKLSFTGSTDVGY
QVAEAAAKHLVPATLELGGKSANIILDDANLDLAVEGIQLGILFNQGEVCSAGSRLLVHE
KIYDQLVPRLQEAFSNIKVGDPQDEATQMGSQTGKDQLDKIQSYIDAAKESDAQILAGGH
RLTENGLDKGFFFEPTLIAVPDNHHKLAQEEIFGPVLTVIKVKDDQEAIDIANDSEYGLA
GGVFSQNITRALNIAKAVRTGRIWINTYNQVPEGAPFGGYKKSGIGRETYKGALSNYQQV
KNIYIDTSNALKGLY
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaaacgttcgagattatatagcagagaattatggtttatttatcaatggggaa
tttgttaaaggtagcagtgacgaaacaatcgaagtgactaatccagcaactggagaaaca
ctatcacatattacaagagcaaaagataaagatgtcgattatgcagtcgaagtggcgcaa
gaggcatttgaatcatggtcattaacttctaaatcagaacgtgcacaaatgttgcgtgat
atttgtgataaattaatggcacaaaaagataaaattgcaatgattgaaacattaaataat
ggtaaaccgattcgtgagacaacagcaattgatattccatttgctgcaagacatttccat
tatttcgcaagtgttattgaaacagaagaaggtacagtgaatgatatcgataaagacaca
atgagtatcgtacgacatgagccgattggcgtcgtaggtgctgttgttgcttggaacttc
ccaatgctattagctgcatggaagattgcgccagccattgctgcaggtaatacaattgtg
attcaaccttcgtcttcaacaccattaagtttattggaagttgctaaaattttccaagag
gtattacctaaaggtgttgtcaatatactaacgggtaaaggttcagaatcaggtaatgca
attttcaatcatgatggtgtagataaattatcatttacgggctcaactgatgtaggttat
caagttgccgaagctgcagcaaaacatctagtacccgctacattagaacttggtggtaaa
agcgccaatatcatattagatgatgctaatttagaccttgcagttgaaggcattcagtta
ggtattttattcaaccaaggtgaagtatgtagtgcaggttctcgattattagttcatgaa
aaaatttatgatcaattggtgccacgtttacaagaggcattttcaaatattaaagttgga
gatccacaagatgaagctacacaaatgggtagtcaaactggtaaggatcaattagataaa
attcaatcatatattgatgcagcaaaagaatcagatgcacaaattttagcaggcggtcat
cgtttaactgaaaatgggttagataaaggattcttctttgaaccgacattaattgctgtg
ccagataatcatcacaaattagcgcaagaagaaatatttggaccagtgttaacagtgatt
aaagtgaaggacgatcaagaagcaattgatatagctaatgattcagagtatggtttagca
ggcggcgtattttctcaaaatatcacacgtgcattaaatattgctaaagctgttcgtaca
ggacgtatttggattaacacttacaaccaagtaccagaaggcgcaccatttggtggttat
aaaaaatcaggtatcggtcgagaaacttataaaggtgcgttaagtaactatcaacaagtt
aaaaatatttatattgatacaagcaatgctttaaaaggtttgtactag

DBGET integrated database retrieval system