KEGG   Staphylococcus aureus subsp. aureus HO 5096 0412 (MRSA): SAEMRSA15_02070Help
Entry
SAEMRSA15_02070   CDS       T02059                                 

Definition
(GenBank) putative zinc-binding dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
sux  Staphylococcus aureus subsp. aureus HO 5096 0412 (MRSA)
Pathway
sux00040  Pentose and glucuronate interconversions
sux00051  Fructose and mannose metabolism
sux01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sux00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SAEMRSA15_02070
   00051 Fructose and mannose metabolism
    SAEMRSA15_02070
Enzymes [BR:sux01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     SAEMRSA15_02070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 NAD_binding_3 FAD_binding_3 AdoHcyase_NAD ADH_N_2 UDPG_MGDP_dh_N TrkA_N adh_short_C2 2-Hacid_dh_C CHASE4
Motif
Other DBs
NCBI-ProteinID: CCG14925
LinkDB All DBs
Position
261429..262484
Genome map
AA seq 351 aa AA seqDB search
MKALVKTREGHGNLELLDKEVATPLDDKVKIKVHYAGICGTDIHTYEGHYKVNFPVTLGH
EFSGEIVEVGADVKDFKVGDRVTSETTFYICNECEYCESKDYNLCNHRKGIGTQVDGAFT
NYVIAREESLHHIPDEVSYQSAAMTEPLACAHHGVSKIQVNSGDVAVVMGPGPIGLLVAQ
VLKSKGATVVVTGLDNDKVRLDKAEALHMDYVVNLQQTDLKTYINGITDGYGADVVVECS
GAVPAARQGLDILRKKGFYSQIGIFKDAEIPFDMEKVIQKEITVVGSRSQKPADWEPSLR
LMADGLVNAEALVTKIYDISKWDEAYQHLKSGEGIKALLKPLDLDENEGEN
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagctttagtaaaaacaagagaaggacatggcaacttagaacttcttgataaagaa
gttgcaacaccgctagatgataaagtaaagattaaagtacattatgcaggaatttgtggc
acagatattcatacttatgaaggtcattataaagttaattttccagtgacattaggtcat
gaattttctggtgaaatcgttgaagttggagcagacgttaaagattttaaagttggtgac
cgtgtcacttctgaaacgacattctatatttgtaatgagtgtgaatactgtgaatcaaaa
gactataatttatgcaaccatcgaaaaggtattggaacacaagttgatggcgcatttact
aattatgtcattgcacgtgaagaaagtttgcatcatattccagacgaagtatcgtatcag
tctgcagctatgacagaaccattagcatgtgcacatcatggtgtttctaagattcaagtc
aattcaggcgatgtagcagttgtaatgggacctgggccaatcggattacttgtagcacaa
gtgttgaaaagtaaaggcgcaactgttgtggtaactggattggacaatgacaaagtcaga
ttagataaagcagaagcattgcacatggattatgtagtcaatttacaacaaacagactta
aaaacgtatatcaatggcattacagacggttacggtgcagatgttgttgttgaatgttca
ggtgcagttccagcagcacgacaaggtttggatattttacgcaaaaaaggtttctacagt
caaataggtatttttaaggatgctgaaattccatttgatatggaaaaagtgattcaaaaa
gaaataacagttgttggtagtagaagtcaaaagccagcagattgggaaccttcattgcga
cttatggcggatggtttagtaaatgctgaagctttggtgacaaaaatatatgatatttcg
aaatgggacgaggcgtatcaacatttaaaatcaggcgaaggtattaaagcattacttaag
ccgctcgatttagatgaaaatgaaggagagaattaa

DBGET integrated database retrieval system