KEGG   Staphylococcus aureus subsp. aureus HO 5096 0412 (MRSA): SAEMRSA15_08410Help
Entry
SAEMRSA15_08410   CDS       T02059                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
sux  Staphylococcus aureus subsp. aureus HO 5096 0412 (MRSA)
Pathway
sux00061  Fatty acid biosynthesis
sux00780  Biotin metabolism
sux01100  Metabolic pathways
sux01130  Biosynthesis of antibiotics
sux01212  Fatty acid metabolism
Module
sux_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sux00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SAEMRSA15_08410 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SAEMRSA15_08410 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SAEMRSA15_08410 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sux01004]
    SAEMRSA15_08410 (fabI)
Enzymes [BR:sux01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     SAEMRSA15_08410 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     SAEMRSA15_08410 (fabI)
Lipid biosynthesis proteins [BR:sux01004]
 Fatty acid synthase
  Component type
   SAEMRSA15_08410 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: CCG15557
LinkDB All DBs
Structure
PDB: 

Position
951532..952302
Genome map
AA seq 256 aa AA seqDB search
MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEA
HLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDI
SSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGP
DNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSG
VTGENIHVDSGFHAIK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatcttgaaaacaaaacatatgtcatcatgggaatcgctaataagcgtagtatt
gcttttggtgtcgctaaagttttagatcaattaggtgctaaattagtatttacttaccgt
aaagaacgtagccgtaaagagcttgaaaaattattagaacaattaaatcaaccagaagcg
cacttatatcaaattgatgttcaaagcgatgaagaggttattaatggttttgagcaaatt
ggtaaagatgttggcaatattgatggtgtatatcattcaatcgcatttgctaatatggaa
gacttacgcggacgcttttctgaaacttcacgtgaaggcttcttgttagctcaagacatt
agttcttactcattaacaattgtggctcatgaagctaaaaaattaatgccagaaggtggt
agcattgttgcaacaacatatttaggtggcgaattcgcagttcaaaattataatgtgatg
ggtgttgctaaagcgagcttagaagcaaatgttaaatatttagcattagacttaggtcct
gataatattcgcgttaatgcaatttcagctggtccaatccgtacattaagtgcaaaaggt
gtgggtggtttcaatacaattcttaaagaaatcgaagagcgtgcacctttaaaacgtaac
gttgatcaagtagaagtaggtaaaacagcggcttacttattaagtgacttatcaagtggc
gttacaggtgaaaatattcatgtagatagcggattccacgcaattaaataa

DBGET integrated database retrieval system