KEGG   Staphylococcus aureus subsp. aureus HO 5096 0412 (MRSA): SAEMRSA15_08550Help
Entry
SAEMRSA15_08550   CDS       T02059                                 

Definition
(GenBank) putative regulatory protein
  KO
K02250  competence protein ComK
Organism
sux  Staphylococcus aureus subsp. aureus HO 5096 0412 (MRSA)
Pathway
sux02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sux00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAEMRSA15_08550
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sux03000]
    SAEMRSA15_08550
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sux02044]
    SAEMRSA15_08550
Transcription factors [BR:sux03000]
 Prokaryotic Type
  Other transcription factors
   Others
    SAEMRSA15_08550
Secretion system [BR:sux02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   SAEMRSA15_08550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComK Gemin7
Motif
Other DBs
NCBI-ProteinID: CCG15571
LinkDB All DBs
Position
complement(970438..971007)
Genome map
AA seq 189 aa AA seqDB search
MYSQNIYVIRKGDMVIRPAFDDDDQRNGSEIIRFDKTRIQNPFKVQKIIERSCKFYGNTY
LGKKAETNRITGISSKPPILLTPLFPTYFFPTHSDRQNENIWLNMHYIESIKELKNRKCK
VTFINNESIILHVSYHSLWHQYNNSIFYYYMVDKQSRMISKNPDQPIDYNKATLNVFEAL
TRYSLFEDK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgtattctcaaaatatttatgtgatacgcaaaggagacatggttattcgaccagcattt
gatgatgacgatcaaagaaacggtagtgaaataattcggtttgacaaaacgcgtattcaa
aatccttttaaagtccagaaaatcattgaacgctcttgcaaattttatggtaatacttat
cttggcaagaaagcagagacaaaccgcattactggcatttctagtaaaccacctatttta
ctaacaccattatttccaacttattttttcccaacacattctgacagacaaaatgaaaat
atttggttaaatatgcattatatcgaaagtattaaagaattaaaaaatcgtaaatgtaaa
gtgacatttattaataatgaatcaatcattcttcatgtttcataccacagtttatggcat
caatataacaattccattttttactattacatggtagataaacaatctcgcatgatatca
aaaaatcccgaccaaccaatagattataataaagccacattgaatgtgtttgaagcattg
acacgctattctttatttgaagataaataa

DBGET integrated database retrieval system