KEGG   Staphylococcus aureus subsp. aureus HO 5096 0412 (MRSA): SAEMRSA15_09780Help
Entry
SAEMRSA15_09780   CDS       T02059                                 

Gene name
sdhA
Definition
(GenBank) putative succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sux  Staphylococcus aureus subsp. aureus HO 5096 0412 (MRSA)
Pathway
sux00020  Citrate cycle (TCA cycle)
sux00190  Oxidative phosphorylation
sux00650  Butanoate metabolism
sux01100  Metabolic pathways
sux01110  Biosynthesis of secondary metabolites
sux01120  Microbial metabolism in diverse environments
sux01130  Biosynthesis of antibiotics
sux01200  Carbon metabolism
Module
sux_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sux_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sux00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAEMRSA15_09780 (sdhA)
   00650 Butanoate metabolism
    SAEMRSA15_09780 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SAEMRSA15_09780 (sdhA)
Enzymes [BR:sux01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SAEMRSA15_09780 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     SAEMRSA15_09780 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored AlaDh_PNT_C Slx4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: CCG15693
LinkDB All DBs
Position
1097018..1098784
Genome map
AA seq 588 aa AA seqDB search
MAEKHLIVVGGGLAGLMSTIKAAEKGAHVDLFSVVPVKRSHSVCAQGGINGAVNTKGEGD
SPWIHFDDTVYGGDFLANQPPVKAMTEAAPKIIHLLDRMGVMFNRTNEGLLDFRRFGGTL
HHRTAYAGATTGQQLLYALDEQVRAYEVDGLVTKYEGWEFLGIVKGDDDSARGIVAQNMT
TAEIETFGSDAVIMATGGPGIIFGKTTNSMINTGSAASIVYQQGAIYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRIWTYKDGKPWYFLEEKYPDYGNLVPRDIATREIFDVCINQK
LGINGENMVYLDLSHKDPHELDVKLGGIIEIYEKFTGDDPRKVPMKIFPAVHYSMGGLYV
DYDQMTNIKGLFAAGECDFSQHGGNRLGANSLLSAIYGGTVAGPNAIDYIANIDRSYTDM
DESIFEKRKAEEQERFEKLMAMRGTENAYKLHRELGEIMTANVTVVRENEKLLETDKKIV
ELMKRYENIDMEDTQTWSNQAVFFTRQLWNMLVLARVITIGAYNRNESRGAHYKPEFPER
NDEEWLKTTMASFQGAFEKPQFTYDDVDVSLIPPRKRDYTSKSKGGKK
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacatcttattgttgtcggaggtggcctagcgggcttaatgtcaacaatt
aaagcggcagaaaaaggtgcacatgtagatttgttctcagttgtaccagtaaagcgttcg
cactctgtttgtgcccaaggtggcattaatggtgcggtcaatactaaaggggaaggcgat
tctccttggattcactttgatgatacagtgtatggtggcgacttccttgcaaaccaacca
cctgttaaagcgatgacagaggcagcacctaaaattattcatttattagaccgtatgggc
gtaatgttcaatagaacaaatgaaggtctattagattttagacgtttcggtggtacatta
caccacagaacagcatatgcaggggcaacaactggacaacaattattatatgcattggat
gaacaagttcgtgcatatgaagtagatggattagttacgaagtatgaaggatgggaattc
cttggcatagttaaaggtgacgatgatagtgcaagaggtatcgttgcacaaaatatgaca
actgctgagattgaaacatttggttcagatgcagttattatggcaacgggtggccccggt
attattttcggtaaaacaacaaactcaatgattaatacaggatcagcggcttccattgtt
taccaacaaggcgctatttatgctaatggtgagttcattcaaattcatcctactgcaatc
cctggtgatgataaacttcgactaatgagtgaatcagcacgtggtgaaggtggacgaatt
tggacatataaagatggtaagccttggtacttcttagaagagaaatatcctgattatggt
aacttagtacctcgtgatatcgcaacgcgtgaaattttcgatgtatgtattaaccaaaaa
ttaggtattaatggcgaaaacatggtatatcttgatttgtcacataaagatccacatgag
ttagatgtaaaactaggtggtatcattgaaatttatgaaaaatttactggtgatgaccca
cgcaaagtaccaatgaagattttcccagctgtccactattcaatgggtggtctatatgta
gattatgatcaaatgacaaatattaaagggttatttgcagctggagaatgtgacttctct
caacatggtggtaaccgcttaggtgccaattcattattgtcagcgatttacggtggtaca
gttgcaggcccgaatgccattgattatattgctaatattgatcgttcatatactgatatg
gatgaaagtatttttgaaaaacgtaaagctgaagaacaagaacgttttgaaaaattaatg
gctatgcgtggtactgaaaatgcttataaattacatcgtgaacttggagaaattatgaca
gctaatgtaacagttgttcgtgaaaatgaaaaactgttagaaacagataaaaagattgtt
gaattgatgaagcgttatgaaaatatagatatggaagatacacaaacttggagtaaccaa
gcggtattcttcactcgtcaactatggaatatgttagtacttgcacgtgtgattacgatt
ggggcatataatcgtaatgaatcacgtggtgcccattataaaccagaattcccagagcgt
aatgacgaagagtggttaaaaacaacaatggcctcattccaaggtgcatttgaaaaacca
cagtttacttatgatgacgtcgatgtgagtttaataccacctcgtaaacgtgattacaca
agtaagtctaaagggggtaaaaaataa

DBGET integrated database retrieval system