KEGG   Staphylococcus aureus subsp. aureus HO 5096 0412 (MRSA): SAEMRSA15_09790Help
Entry
SAEMRSA15_09790   CDS       T02059                                 

Gene name
sdhB
Definition
(GenBank) putative succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
sux  Staphylococcus aureus subsp. aureus HO 5096 0412 (MRSA)
Pathway
sux00020  Citrate cycle (TCA cycle)
sux00190  Oxidative phosphorylation
sux00650  Butanoate metabolism
sux01100  Metabolic pathways
sux01110  Biosynthesis of secondary metabolites
sux01120  Microbial metabolism in diverse environments
sux01130  Biosynthesis of antibiotics
sux01200  Carbon metabolism
Module
sux_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sux_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sux00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAEMRSA15_09790 (sdhB)
   00650 Butanoate metabolism
    SAEMRSA15_09790 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SAEMRSA15_09790 (sdhB)
Enzymes [BR:sux01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SAEMRSA15_09790 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     SAEMRSA15_09790 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_9 Fer4_10 Fer4_17 Fer4_2 Fer4_16 Fer4_15 Fer4 Fer4_13 Fer4_21 Fer4_6 Fer4_4 Fer4_18
Motif
Other DBs
NCBI-ProteinID: CCG15694
LinkDB All DBs
Position
1098784..1099599
Genome map
AA seq 271 aa AA seqDB search
MTDQPVKDTPQHETQSKPKQKTVKLIIKRQDTSDSKPYEETFEIPYRENLNVIACLMEIR
RNPVNIKGEKTTPVVWDMNCLEEVCGACSMVINGRARQSCSAIVDQLEQPIRLEPMNTFP
VIRDLQVDRSRMFDNLKRMKAWIPIDGTYDLGPGPRMPEKKRQTAYELSKCMTCGVCLEV
CPNVTENNKFVGAQAISQVRLFNLHPTGSMTKDERLNALMGTGGLQQCGNSQNCVNACPK
GIPLTTSIAAMNRETTFHMFKSFFGSDHEVE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgactgaccaaccagtaaaagacacaccacaacatgaaacacaatctaaaccgaaacaa
aaaacagtaaaattaattattaaacgtcaagatacaagtgattcaaaaccatatgaagaa
acgtttgaaattccgtatcgtgaaaatttaaatgtcattgcatgtttaatggaaattaga
cgtaatccagttaatattaaaggcgaaaaaacaacgccagtagtatgggacatgaactgt
ttagaagaagtatgtggtgcgtgttcaatggttatcaatggtcgtgcaagacaatcatgt
tcagcgattgttgatcaattagaacagcctattcgattagagcctatgaatacattccca
gttatccgtgacttacaagttgatcgttctagaatgttcgataacttaaaacgtatgaaa
gcatggatcccaattgatggaacgtatgatttaggtccgggaccacgtatgccagagaaa
aaacgtcaaacagcttatgaattatctaaatgtatgacatgtggtgtatgtttagaggtt
tgtcctaatgttactgaaaataataaattcgttggtgcgcaagcaatctcgcaagttcgt
ttgtttaatttgcacccaacaggatctatgactaaagatgaacgtttaaatgcattaatg
ggtactggtggcttacagcagtgtggtaattcacaaaactgtgttaatgcttgccctaaa
ggtattccattaacaacatccattgcagcaatgaacagagaaacaacattccacatgttt
aaatctttctttggttcagaccatgaagtagaataa

DBGET integrated database retrieval system