KEGG   Staphylococcus aureus subsp. aureus HO 5096 0412 (MRSA): SAEMRSA15_16080Help
Entry
SAEMRSA15_16080   CDS       T02059                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sux  Staphylococcus aureus subsp. aureus HO 5096 0412 (MRSA)
Pathway
sux00010  Glycolysis / Gluconeogenesis
sux00030  Pentose phosphate pathway
sux00051  Fructose and mannose metabolism
sux00052  Galactose metabolism
sux00680  Methane metabolism
sux01100  Metabolic pathways
sux01110  Biosynthesis of secondary metabolites
sux01120  Microbial metabolism in diverse environments
sux01130  Biosynthesis of antibiotics
sux01200  Carbon metabolism
sux01230  Biosynthesis of amino acids
sux03018  RNA degradation
Module
sux_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sux_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:sux00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAEMRSA15_16080 (pfkA)
   00030 Pentose phosphate pathway
    SAEMRSA15_16080 (pfkA)
   00051 Fructose and mannose metabolism
    SAEMRSA15_16080 (pfkA)
   00052 Galactose metabolism
    SAEMRSA15_16080 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    SAEMRSA15_16080 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    SAEMRSA15_16080 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sux01009]
    SAEMRSA15_16080 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sux03019]
    SAEMRSA15_16080 (pfkA)
Enzymes [BR:sux01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SAEMRSA15_16080 (pfkA)
Protein phosphatases and associated proteins [BR:sux01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SAEMRSA15_16080 (pfkA)
Messenger RNA biogenesis [BR:sux03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SAEMRSA15_16080 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: CCG16319
LinkDB All DBs
Structure
PDB: 

Position
complement(1767977..1768945)
Genome map
AA seq 322 aa AA seqDB search
MKKIAVLTSGGDSPGMNAAVRAVVRTAIYNEIEVYGVYHGYQGLLNDDIHKLELGSVGDT
IQRGGTFLYSARCPEFKEQEVRKVAIENLRKRGIEGLVVIGGDGSYRGAQRISEECKEIQ
TIGIPGTIDNDINGTDFTIGFDTALNTIIGLVDKIRDTASSHARTFIIEAMGRDCGDLAL
WAGLSVGAETIVVPEVKTDIKEIADKIEQGIKRGKKHSIVLVAEGCMTAQDCQKELSQYI
NVDNRVSVLGHVQRGGSPTGADRVLASRLGGYAVDLLMQGETAKGVGIKNNKIVATSFDE
IFDGKDHKFDYSLYELANKLSI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattgcagttttaactagtggtggagattcacctggaatgaatgctgcggta
agagcagttgttcgtacagcaatttacaatgaaattgaagtttatggtgtgtatcatggt
taccaaggattgttaaatgatgatattcataaacttgaattaggatcagttggggatacg
attcagcgtggaggtacattcttgtattcagcaagatgtccagagtttaaggagcaagaa
gtacgtaaagttgcaatcgaaaacttacgtaaaagagggattgagggccttgtagttatt
ggtggtgacggtagttatcgcggtgcacaacgcatcagtgaggaatgtaaagaaattcaa
actatcggtattcctggtacgattgacaatgatatcaatggtactgattttacaattgga
tttgacacagcattaaatacgattattggcttagtcgacaaaattagagatactgcgtca
agtcacgcacgaacatttatcattgaagcaatgggccgtgattgtggagatctagcatta
tgggctggattatcagttggtgctgagacaattgtagtaccagaagtgaaaacagatatt
aaagaaatagctgataaaattgaacaaggtattaaacgtggtaagaaacactcaatcgtt
cttgtagcagaaggttgcatgactgcgcaagattgtcaaaaagaattatcacaatacatc
aatgttgataatagagtgtctgtgttaggtcacgttcaacgtggtggtagcccaacaggt
gcggatagagttttagcatcacgtttaggtggatatgcggtagacttattaatgcaaggt
gaaacagctaagggtgttggaattaagaacaataaaattgtagcaacatcttttgatgaa
atttttgatggtaaagatcataaatttgattatagtctatatgaacttgctaacaagtta
tctatataa

DBGET integrated database retrieval system