KEGG   Sulfurifustis variabilis: SVA_0423Help
Entry
SVA_0423          CDS       T05321                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
sva  Sulfurifustis variabilis
Pathway
sva00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sva00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SVA_0423
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sva01003]
    SVA_0423
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sva01011]
    SVA_0423
Enzymes [BR:sva01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     SVA_0423
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SVA_0423
Glycosyltransferases [BR:sva01003]
 Polysaccharide
  Bacterial polysaccharide
   SVA_0423
Peptidoglycan biosynthesis and degradation proteins [BR:sva01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   SVA_0423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase UB2H UvrB_inter
Motif
Other DBs
NCBI-ProteinID: BAU47005
UniProt: A0A1B4V173
LinkDB All DBs
Position
complement(419531..421825)
Genome map
AA seq 764 aa AA seqDB search
MTGRRRPARPSRSRRVLLVLAALGLLFGLYTIYLDFTVRSHFEGKRWALPARVYASPLEI
YPGRHLSAVDLGEELVALGYRSGTSGEPGTFQRTRDAFEIVTRPFTFWDGPQPAMHVRLT
FDGDRVAALEDPEGRSIPIARLDPLLIGGIYPAHNEDRVLVKLDEVPPVLVKALLAIEDR
KFYQHHGVDPRGIARALLANVRAGDAVQGGSTLTQQLVKNFYLSAERTLSRKLNEALMAL
LLDAHYGKDEILEAYLNEIYLGQDGSRAIHGFGLAAQHYFDRPLPHISLTQAALLVGLVK
GPSYYDPRRNPKRALERRNLVLAELAERGVITTADYLRAKAAPLEVTAKAPVGTSPYPAF
LGLVHRQLRRDYSESDLRSEGLLIFTTLDPRTQRAAEKSLTSRLGALEKQRRLPAGSLEG
AVIVTSTEHGEILGLVGGRNARFEGFNRALDAERQVGSVIKPAVYLAALSRPEKYTLVTP
LDDSPLSWKEPGIDEWTPQNYDREFHGEVDLRTALAESYNVSAARLGLSLGVPEVVDQAR
RLGVERALPPYGSTLLGSVTLTPFEVTQMYQTIASGGFRTPLRAIREVMTPQGEPLKRYG
IAVEQAADPGAVYLLTTALQHAVRAGTGTGLSRYLAAELDVAGKTGTTNDLRDSWFAGFT
GDRLAVVWVGRDDNQPAGLTGASGALTVWGDMMARLDPEPLVPAAPENIEMVAIDPDTRL
RADSGCAGIELPFIRGSAPVETAPCAAGTPAKALKGWFRRLLER
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
gtgactggccgccgtcgtcccgcacgcccttcccgctcgaggcgagttcttctcgtcctc
gccgctctgggacttcttttcggtctttacacgatctacctggatttcaccgtgcgctcg
catttcgagggcaagcggtgggcgttgcccgcgcgcgtctacgcaagcccgctcgaaatc
tatccgggccgacacctgtccgcggtcgatctcggcgaggagctggtggcccttggctac
cgaagcggcacatccggcgagccgggaacgttccagcgaacgcgcgacgccttcgagatc
gtgacgcggccgttcacgttctgggacggtccgcagccggcgatgcacgtacgcctcacg
ttcgacggcgaccgggtcgccgcgctcgaggatccggaagggaggagcatccctatcgcg
cgactggatccgttgctgatcggcgggatctacccggcccacaacgaagaccgggtgctg
gtgaagctcgacgaggtaccgccggtactggtcaaggcgctactcgccatcgaggaccgc
aagttctaccagcaccacggcgtagacccgcgcgggatcgcgcgtgcgctgctcgccaac
gtgcgcgccggggacgcggtgcagggcggtagcacgctgacgcagcagctcgtcaaaaac
ttctacttgagcgccgagcgcaccctgtcgcgcaagctgaacgaggcgctcatggcgctg
ctgctcgacgcgcactacggaaaggacgagatcctcgaggcgtacctcaacgagatctac
ctcggtcaggacggcagtcgcgcgatccacggctttgggctcgccgcgcagcattacttc
gaccgcccgctaccccacatttcgctgacgcaggcggcgctgctggtcggcctcgtcaag
ggaccgtcctattacgatcctcggcggaatccgaagcgcgcactcgaacgacggaacctc
gtgctggccgagctcgcagagcgaggtgtcatcacgacggccgattacctgcgtgcgaag
gccgcgccgctcgaggtgacggcaaaggcgccggtcggcacgtccccttatcccgcgttc
ctcggactggtgcaccgtcagctgcgtcgcgattactcggagagcgacctccgctctgag
ggactgctgatcttcaccacgctcgacccccgaacgcagcgagccgccgagaagtcgctg
acgagccggctcggcgcactcgagaagcagcgccgtctcccggccggctcgctcgagggt
gcggtgatcgtgacgagcacggagcacggcgagatcctcggcctcgtcggcgggcggaat
gcccgcttcgagggtttcaaccgcgcactcgacgcggagcggcaggtgggctcggtgatc
aagcccgcggtgtacctcgcggcgctgtcgcgccccgagaagtacacgctcgtaacgccg
ctcgacgacagtccgctgagctggaaggagccgggcatcgacgagtggacaccgcagaac
tatgaccgcgagttccacggtgaggtggatctgcggactgccctcgccgagtcctacaac
gtctccgccgcgcgcctcggccttagcctcggcgtgccggaggtggtcgatcaggcgcgc
cgcctgggggtcgaacgcgccctgcccccttacggttccacgctgctcgggagcgtcacg
ctgacgccctttgaggtgacccagatgtatcaaacgatcgcgagcggcggcttccggacc
ccgctgcgtgccattcgggaggtcatgactcctcaaggagagccgctcaagcgctacggc
atcgccgtcgagcaggcagctgatcccggggcggtgtacctgctcaccaccgctcttcag
cacgccgtgcgtgcgggcaccggcacgggcctctcgcgttatctcgctgcggagctcgac
gtcgccggcaagaccggaaccaccaacgacctgcgcgacagctggtttgccgggttcacc
ggtgatcggctcgccgttgtctgggtcggtcgcgatgacaaccagccggccgggctcacc
ggcgcgagcggcgcgctgaccgtctggggagacatgatggcgcggctcgatccggaaccg
ctcgtccccgccgctccggagaacatcgagatggtcgctatcgaccccgacacccggttg
cgcgccgatagcggctgcgccggcattgagctacctttcatccgtggttccgcccccgtc
gaaacggcgccctgcgccgccgggacgccggcgaaggcgttgaaaggatggttccggagg
ttgctggagcgatga

DBGET integrated database retrieval system