KEGG   Sulfurifustis variabilis: SVA_0689Help
Entry
SVA_0689          CDS       T05321                                 

Definition
(GenBank) cell division protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
sva  Sulfurifustis variabilis
Pathway
sva00550  Peptidoglycan biosynthesis
sva01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sva00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SVA_0689
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    SVA_0689
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sva01011]
    SVA_0689
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sva03036]
    SVA_0689
Enzymes [BR:sva01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SVA_0689
Peptidoglycan biosynthesis and degradation proteins [BR:sva01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   SVA_0689
Chromosome and associated proteins [BR:sva03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    SVA_0689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer PepSY
Motif
Other DBs
NCBI-ProteinID: BAU47268
UniProt: A0A1B4V1A6
LinkDB All DBs
Position
679184..680893
Genome map
AA seq 569 aa AA seqDB search
MTRARPHPYRLRQWLVLAFLIAGLVLLGARAIYLQVISADYLKTQGNARHTRIVKDNSHR
GMILDRSGVPLAISTPVDSVWAHPATLLGERRSHAALARLLDTTPAELARLLARNREREF
VYLKRHVPPAVASRVAALQAPGVSLLREYRRYYPAGAVTGHVLGFTNVDDQGQEGIELAY
DAWLRAIPGTKRVLKDLHGTAVEVVESVRLPTPGKDLVTSLDRRVQYLAYRELKAAVEEH
GARAGAAVVLDAYTGEVLALVNEPDFNPNNRGTFKGAMFRNRAVTDLFEPGSTLKPFTVA
TALESGKFTPSTLVDTSPGTMLVGGKTIRDLHNYGVISVARVIEKSSNVGTGKIALALDK
RMLWDTFRRVGFGAVTGSQLPGETAGLLNSPASWVPIDQVSMSYGYGISVTPLQLARAYA
ALANGGELVPVTLLRQDAEPPRPRVFSPRVATAVRQMLELAVDQGTGGAARVADYRVAGK
TGTVHKLTGTGYADDDYVAWFAGFAPVRNPRLVMVVAIDGPRRGRHFGGDVAAPVFGHVM
SGALRLLDIAPDAPRPPATRLVSARAGDR
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcgcgcgcggccccatccctaccgtctgcggcagtggctggtgctcgccttcctg
atcgccgggctcgtgctcctcggcgcaagagcgatctatctgcaggtgatcagcgccgat
tatctgaagacacagggaaacgcgcgccacacgcggatcgtgaaggacaactcccaccgc
gggatgattctcgaccgcagcggagttccgctcgccatcagcacgccggtcgactcggtg
tgggcacacccggcgaccttgttgggggagcgcaggagccacgcggcgctcgcgcgtctt
ctggacacgacgccggccgagctcgcccgactgctcgcgcgtaaccgggaacgcgagttc
gtgtacctcaagcggcacgtgccgccggcggtggccagtcgcgtggcggcgctccaggcg
ccgggcgtctcgctgctgcgggaataccgccgctactacccggcgggcgccgtgaccggc
cacgttctcggtttcacgaacgtggacgaccagggccaggagggcatcgagctcgcctac
gacgcctggttgcgtgcgattcccggcaccaagcgcgtgctcaaggacctgcacgggacg
gcggtggaggtcgtcgagagcgtgcgcttgccgacgcccggcaaggatctggtgacgagc
ctcgatcgccgcgtgcaatacctcgcgtatcgtgagctcaaggccgcagtggaggagcat
ggcgcgcgcgccggcgccgcggtcgtcctcgacgcctacaccggcgaagtgctcgccctc
gtgaacgaacccgatttcaaccccaacaaccgcggcactttcaagggcgcgatgttccgt
aatcgcgccgtgaccgacctgttcgagccgggctcgacgctcaagccgttcaccgtcgcg
accgcgctcgagagcggcaagttcacgccctccaccctggtcgacacctcgcccggcacg
atgctggtcggcggcaagacgatccgcgatctccacaactacggcgtcatctcggtcgcg
cgcgtcatcgagaaatcgagcaacgtgggtacgggcaagatcgcgctcgccctcgacaag
cgcatgctgtgggacacgttccggcgcgtcggcttcggagcggtcaccgggagccagctg
cccggcgaaacggccgggttgctcaattccccggccagctgggtaccgatcgatcaggta
agcatgtcgtacgggtacggcatctcggtcacgccgttgcagctcgcacgcgcctacgcg
gcgctcgcgaatggcggcgagctcgttccggtgaccctgctgcgccaggacgcggagccg
ccccggccgcgcgtgttctccccgcgcgtggccaccgccgtccgtcagatgctcgagctc
gccgtggaccagggaacgggcggggccgcgcgggtggccgactaccgcgtcgcgggaaag
accggcacggtgcacaagctgacgggcaccggctatgccgacgacgactacgtcgcctgg
ttcgccggctttgccccggttcggaatccgcgcctggtgatggtcgtggcgatcgacggt
ccccgtcgcgggcggcacttcggcggcgacgtggctgcgccggtgttcggccacgtgatg
tcgggcgccctgcgcctcctcgacatcgcccccgatgcgccgcggccgccggctacccgg
ctcgtttccgcgagagcgggggaccgatga

DBGET integrated database retrieval system