KEGG   Sulfurifustis variabilis: SVA_1144Help
Entry
SVA_1144          CDS       T05321                                 

Definition
(GenBank) nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
  KO
K00768  nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase [EC:2.4.2.21]
Organism
sva  Sulfurifustis variabilis
Pathway
sva00860  Porphyrin and chlorophyll metabolism
sva01100  Metabolic pathways
Module
sva_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:sva00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SVA_1144
Enzymes [BR:sva01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.21  nicotinate-nucleotide---dimethylbenzimidazole phosphoribosyltransferase
     SVA_1144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DBI_PRT TetR_C_20
Motif
Other DBs
NCBI-ProteinID: BAU47719
UniProt: A0A1B4V2G8
LinkDB All DBs
Position
1149708..1150772
Genome map
AA seq 354 aa AA seqDB search
MSAQRWRDPVRVPDVACARAARARQARLTKPPGSLGRLEEVVCRLAALQASERPRVDAVR
IVVFAADHGVAAQGVSAFPQAVTAEMVRNFARGGAAINVLARSLGASLEVVNLGTVHETG
RLPGVIDRPIGSGTADLAREPAMAEAQLLEALAAGGEAAERAGRAEVDLLIGGDMGIGNT
TAASAVASALLSVPPRYLAGPGTGLDAAGVRRKAAVIEHALALHGSALAEPLEVLRRLGG
FEIAALVGLYLRGAQLGIPLLVDGFIATTAALVAVRVNASAREWFIYAHRSAEPGHRMVL
ETLQAEPLLSLGMRLGEASGAAVAVPLLRLACALHEEMATFEEAGVSAGPEPQP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgcaacgctggcgcgaccccgtacgcgtgccggatgtcgcctgcgcccgcgcc
gcccgggcccgtcaggcgcggctcaccaagccacccggttcgttgggtcgtctcgaggag
gtcgtctgccggctcgcggcgctgcaggcgagcgagcgtccgcgcgtcgacgcggtgcgc
atcgtggtctttgccgcggaccacggcgtggcggcgcaaggcgtgtcggcgtttccccaa
gcagtcacggccgagatggtgcgcaattttgcgcgtggcggcgcggcgatcaacgtgctc
gcgcgctcgctcggcgcctcgctcgaggtcgtgaacctgggtaccgtgcacgaaaccggc
cggcttccgggcgtcatcgatcggccgatcggttccgggaccgctgacctggcgcgggag
ccggcgatggccgaggcgcagttgctggaagcgctcgccgccggcggcgaggcggcggag
cgcgccggtcgagcggaagtggatcttctgatcggcggagacatgggcatcggcaatacc
accgccgcctcggcggtcgcgtccgcgctgctgtcggtcccaccgcggtacctggccgga
ccgggcaccgggctcgacgccgccggggtacggcgcaaggccgccgtcatcgagcacgcc
ctcgccctgcacggcagcgcgctcgccgaaccgctcgaggtgttgcgccgcctgggaggg
ttcgagattgcggcgctcgtgggtctctacctgcgcggcgcgcagctcgggataccgctg
ctcgtggacggcttcattgcgacgaccgcggcgctcgtggccgtgcgcgtcaacgcgtcc
gcgcgggaatggttcatctatgcgcatcgttccgccgagccgggacaccggatggtgctg
gaaacgctgcaggccgaacctttgttgagcctgggcatgcggttgggcgaggcgagcggc
gccgccgtcgccgttcccctgctgcgactggcctgcgcgctgcacgaagagatggcgacc
ttcgaggaagcgggcgtctccgccggaccggagccgcaaccgtga

DBGET integrated database retrieval system