KEGG   Sulfurifustis variabilis: SVA_1412Help
Entry
SVA_1412          CDS       T05321                                 

Definition
(GenBank) glutathione S transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sva  Sulfurifustis variabilis
Pathway
sva00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sva00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SVA_1412
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sva02000]
    SVA_1412
Enzymes [BR:sva01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SVA_1412
Transporters [BR:sva02000]
 Other Transporters
  Pores ion channels [TC:1]
   SVA_1412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N_2 GST_N_3 GST_N GST_C_2 GST_C_3 GST_C_6
Motif
Other DBs
NCBI-ProteinID: BAU47977
UniProt: A0A1B4VDH3
LinkDB All DBs
Position
complement(1409974..1410582)
Genome map
AA seq 202 aa AA seqDB search
MKLYFYPGACSMAPHIVLRELGLTFDLDQVDLQAKKTKGGEDFGAVNPKGYVPALRLDDG
EVLTEVAVVLQYLADLKPDAGLLPKAGTMERYRVLEWLNFISSEVHKQFSPFFNPKITPE
WRANQLNLLGRRFDYLSARLGDRPYLTGAAFTVADAYLFTVLNWHKLFDIDLGKWPVLKD
YHARIMARASVKDSLRAEGLAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctatttctatcccggcgcatgctcgatggcgccccatatcgttttgcgcgag
ctcggactgacgttcgacctggatcaggtggacctgcaggcgaagaagacgaagggcggc
gaggacttcggcgcggtcaacccgaagggctacgtccccgcgttgcggctcgacgacggg
gaggtgctcacggaagtggcggtcgtccttcagtacctcgcggacctcaagccggatgcg
ggactgctgccgaaggcgggcacgatggagcgttatcgcgtgctcgagtggctcaacttc
atttcgtccgaagtgcacaagcagttcagcccgttcttcaacccgaagatcacgcccgag
tggcgcgcgaaccagttgaacctcctcggccgccggttcgactacctgtccgcgcgactc
ggcgacaggccgtatctcaccggtgcggccttcacggtcgccgacgcctacttgttcacg
gtcctgaactggcacaagctgttcgacatcgatctcggcaagtggccggtactgaaggac
taccacgcgcgcatcatggcgcgggcgtccgtcaaggattcgctgcgggcggaaggactg
gccaagtaa

DBGET integrated database retrieval system