KEGG   Sulfurifustis variabilis: SVA_3361Help
Entry
SVA_3361          CDS       T05321                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
sva  Sulfurifustis variabilis
Brite
KEGG Orthology (KO) [BR:sva00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sva03012]
    SVA_3361
   03029 Mitochondrial biogenesis [BR:sva03029]
    SVA_3361
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sva04147]
    SVA_3361
Translation factors [BR:sva03012]
 Eukaryotic Type
  Elongation factors
   SVA_3361
 Prokaryotic Type
   SVA_3361
Mitochondrial biogenesis [BR:sva03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SVA_3361
Exosome [BR:sva04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SVA_3361
  Exosomal proteins of breast cancer cells
   SVA_3361
  Exosomal proteins of colorectal cancer cells
   SVA_3361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: BAU49908
UniProt: A0A1C7AF74
LinkDB All DBs
Position
complement(3398786..3399976)
Genome map
AA seq 396 aa AA seqDB search
MSKEKFARTKPHLNVGTIGHVDHGKTTLTAALTKVLSTKYGGEVRAYDQIDNAPEERERG
ITIATSHVEYQSEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVYLNKADMVDDKDLLELVQEEVRDLLTKYGFPGKDTPIITGSALKALE
GDQSELGEPSIVKLAEALDAYVPQPKREIDKPFLMPIEDVFSISGRGTVVTGRVERGIVK
VGDEVEIVGIKPTTKTTVTGVEMFRKLLDQGEAGDNVGVLLRGTKREEVERGQVLAKPGS
ITPHTKFEAEVYVLTKEEGGRHTPFFNGYRPQFYFRTTDVTGSVDLPQGTEMVMPGDNIK
MTVTLINPIAMEEGLRFAIREGGRTVGAGVVAKVIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggaaaaattcgcacgcaccaagccccacctgaacgtcggcaccatcggccac
gtcgaccacggcaagacgacgctgaccgcggcgctgacgaaggtgctctcgaccaagtac
ggcggcgaggtccgggcgtacgaccagatcgacaacgcccccgaggagcgcgagcgcggc
atcaccatcgcgacctcccacgtcgagtaccagagcgagaagcgtcactacgcccacgtc
gactgcccgggccatgccgactacgtgaagaacatgatcaccggggccgcgcagatggac
ggcgcgatcctggtcgtgtccgccgccgacggcccgatgccccagacccgcgagcacatc
ctgctcgcccgccaggtgggcgtgccctacatcgtcgtgtacctgaacaaggccgacatg
gtcgacgacaaggacctcctcgagctcgtccaggaagaggtccgggacctgctcaccaag
tacggcttccccggcaaggacaccccgatcatcaccggcagcgcgctcaaggcgctcgaa
ggcgaccagtccgagctcggcgagccctcgatcgtcaagctcgccgaggccctcgacgcc
tacgtgccccagcccaagcgcgagatcgacaagccgttcctcatgccgatcgaggacgtg
ttctcgatctccggccgcggcaccgtggtcacgggccgggtcgagcgcggcatcgtcaag
gtgggcgacgaggtcgagatcgtcggcatcaagccgaccaccaagaccaccgtcaccggg
gtcgagatgttccgcaagctcctcgaccagggcgaggccggcgacaacgtcggcgtgctc
ctgcgcggcaccaagcgcgaggaagtcgagcgcggccaggtgctggcgaagcccggctcc
atcacgccgcacaccaagttcgaggcggaagtctacgtcctcaccaaggaagagggcggg
cgccacacgccgttcttcaacggctaccggccccagttctacttccggacgaccgacgtc
acgggctcggtcgacctcccccagggcaccgagatggtcatgcccggggacaacatcaag
atgaccgtcaccctcatcaacccgatcgccatggaagagggcctgcgcttcgccatccgc
gaaggcggccgcaccgtgggggcgggggtggtggcgaaggtgatcgagtaa

DBGET integrated database retrieval system