KEGG   Streptomyces venezuelae: SVEN_0307Help
Entry
SVEN_0307         CDS       T02274                                 

Definition
(GenBank) Sialidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
sve  Streptomyces venezuelae
Pathway
sve00511  Other glycan degradation
sve00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SVEN_0307
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SVEN_0307
Enzymes [BR:sve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SVEN_0307
Bacterial toxins [BR:sve02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SVEN_0307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 Laminin_G_3 Laminin_G_2 BNR Laminin_G_1 BNR_3 FixQ
Motif
Other DBs
NCBI-ProteinID: CCA53594
UniProt: F2R5T3
LinkDB All DBs
Position
325494..327503
Genome map
AA seq 669 aa AA seqDB search
MTSLSERRPPDARRFARSAWLCALALTLLAAVAFAVSPPSPATAATAGTTTPPLATQVSN
TPFKARENYYCTRIPALVTSTKGVLLAFAEGRNRLTTTGCHDVGDNDLVLKRSLDGGATW
QALQVVVGAGDELAHGNPAPVVDAVSGRITLLYSSSEWNHDGAKPSRAGYARTVHAIHST
DDGATWSASVPQPQLKAAGWGWVSTGPGHGIQLGRGPHHGRLIVPGDHTAGGDTTAGGQL
YISDNGGLTWAIGARSESAKSGAYPGELTVAQTVDGGVYVNARNSEPTRCLTNEHRLETV
SPDGGDSFAAPFTPVANLDTSPVFGSLLRLHAQDQDAKPNRLLYSGASRLGPSPLEDRRE
LAIRSSYDEGKTWRTVGTLVSAARTGYSDLTLLPSGSIGILYETAGNIPHGNVAFGAFTE
QAMQDSETELRRPRTGDTHVRAAGEAGNHAIVHGGARLGTRHDGVAMEFDGQDDYLRLVC
SPSLRVDDKDFTVTAWFRHSAATGTLPIIWAYGMPGTDPLKKGRHFSVRAEPGGNLLRAT
VGTDIGSTEVTLPSSYNDGTWHHVVFTRQGLTIGLAVDGQPAATATMPAGNSAADRNVTP
AAEFNIHIGARPDFPNQPAGVAQLFHGTLDDVRLFRTALTDAEAARVKAGALDVATDREK
LRLGFTTIW
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccctgtccgagcgccgtccaccggacgcgcgccgcttcgcacggtccgcgtgg
ctgtgcgcgctcgccctcaccctcctggccgcggtcgcgttcgcggtgtcgccgccgtcg
cccgcgaccgcggcgacggcgggcaccaccaccccgccgctcgccacccaggtctccaac
acgccgttcaaggcgcgcgagaactactactgcacgcgcatacccgccctcgtcaccagc
acgaagggcgtgctcctcgccttcgccgagggccgcaaccggctgacgacgaccggctgc
cacgacgtcggcgacaacgacctcgtgctcaagaggtccctcgacggcggtgcgacctgg
caggccctccaggtcgtcgtcggcgcgggcgacgagctcgcccacggcaaccccgctccg
gtcgtcgacgccgtctccggccggatcaccctgctgtactccagcagcgagtggaaccac
gacggcgccaagccctcccgcgcgggctacgcacgcacggtgcacgcgatccacagcacg
gacgacggggcgacctggtccgcgagcgtgccgcagccgcagctcaaggccgccggctgg
ggctgggtctccaccggcccaggccacggcatccagctcggccggggaccgcaccacggc
cggctgatcgtccccggcgaccacacggccggcggtgacacgaccgccggcggtcagctg
tacatcagcgacaacggcggcctcacctgggcgatcggcgcccggtccgagtcggccaag
tccggtgcttacccaggcgagttgaccgtcgcccagaccgtcgacggcggcgtctacgtc
aacgcccgcaactccgagcccacgcgctgcctcaccaacgagcaccggctggagaccgtc
agcccggacggcggcgactccttcgcggcccccttcaccccggtggccaacctggacacc
tccccggtgttcggctcgctgctgcggctccacgcccaggaccaggacgcgaagcccaac
aggctgctgtactcgggtgcctcccggctcggccccagcccgctggaggaccggcgcgaa
ctggccatccgctcctcgtacgacgaagggaagacctggcggaccgtcggcaccctcgtc
tccgccgcccgcaccggctactccgatctgacgctgctgccgagcggctcgatcggcatt
ctgtacgagacggccggcaacatcccgcacggcaacgtggcgttcggcgccttcaccgag
caggccatgcaggactcggagaccgagctgcgccgcccgcgcaccggcgacacccacgtc
cgcgccgccggcgaggccggcaaccacgccatcgtccacggcggcgcgcggctgggaacg
cgtcacgacggggtcgccatggagttcgacggccaggacgactacctgcgcctcgtctgc
tcgccgtcgctgcgggtcgacgacaaggacttcaccgtcacggcctggttcaggcactcc
gccgcgaccggcacactgccgatcatctgggcgtacggcatgcccggcaccgacccgttg
aagaagggacgtcacttctcggtccgggccgaaccgggcggcaatctcctgcgggccacg
gtcggcacggacatcggctccaccgaggtgacgctcccgtcctcgtacaacgacggcacg
tggcaccacgtggtcttcacccggcagggcctcaccatcggcctcgccgtggacgggcag
ccggcggccaccgcgaccatgccggcggggaactccgccgcggaccggaacgtcactccg
gccgccgagttcaacatccacatcggcgcccgtcccgacttccccaaccagccggccggg
gtggcccagctcttccacggcaccctggacgacgtgcggctcttcaggaccgccctcacc
gacgccgaagcggccagggtgaaggccggcgccctcgacgtcgcgaccgaccgggagaag
ctccgcctcggcttcaccaccatctggtaa

DBGET integrated database retrieval system