KEGG   Streptomyces venezuelae: SVEN_2038Help
Entry
SVEN_2038         CDS       T02274                                 

Definition
(GenBank) Aldehyde dehydrogenase
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CCA55325
UniProt: F2RKT6
LinkDB All DBs
Position
complement(2248831..2250294)
Genome map
AA seq 487 aa AA seqDB search
MTELVEHGKLFIGGELTDPLGADVIEVVSPHTEEVIGRVPHASTADVDAAVAAARRAFDE
GPWPRMTLEERIAVVGRIKDAIAVRHEEIARSISAQNGSPYSWSVLAQALGAMMVWDAAI
TVARDFTYEERRGGVLGPLLVRREPVGVVAAVVPWNVPQFTAAAKLGPALLAGCTVVLKP
SPESPLDSYILADIATEAGLPEGVLSIVPADREVSEYLVGHPGIDKVSFTGSVAAGKRVM
EVASRNLTRVTLELGGKSAAVILPDADLATAVAGIVPAAWMNNGQACVAQTRILAPRSRY
EEIAEAFAAAAGALVVGDPLDPATQVGPLVAQRQQRRSLDYIRIGQDEGAKVLAGGGRPA
GLDRGWYVEPTLFGGVDNSMRIAREEIFGPVICLLPYGDEAEALRIANDSDFGLSGSVWT
GDVEHGVDFARGVRTGTFNVNTFSLDMLGPFGGYKNSGLGREFGPEGLGEYLEHKMIHLP
AGYEGGA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcttgtggagcacggaaagctgttcatcggcggggagttgaccgacccgctc
ggcgcggacgtcatcgaggtcgtctccccgcacaccgaggaggtcatcggccgcgtcccg
cacgcctccaccgccgacgtcgacgccgccgtcgccgccgcgcgccgggccttcgacgag
gggccctggccgcggatgacgctggaggagcggatcgcggtcgtcggccgcatcaaggac
gcgatcgccgtccggcacgaggagatcgcccgctccatcagcgcgcagaacggctccccg
tactcctggtccgtgctcgcccaggcgctcggcgcgatgatggtgtgggacgcggcgatc
accgtcgcccgcgacttcacgtacgaggagcggcgcggcggcgtcctcgggccgctgctc
gtgcggcgcgagccggtgggggtggtcgcggccgtcgtcccgtggaacgtgccgcagttc
accgccgccgccaagctggggcccgcgctgctcgcgggctgcacggtggtcctcaagccc
tcgccggagtcgcccctcgactcgtacatcctggccgacatcgccaccgaggccgggctg
cccgagggggtgctgagcatcgtgcccgccgaccgcgaggtcagcgagtacctcgtcggc
caccccgggatcgacaaggtgtccttcaccggctcggtcgccgccggcaagcgggtcatg
gaggtcgcctcccgcaacctcacccgcgtcaccctcgaactcggcgggaagtcggccgcc
gtgatcctgccggacgcggacctcgcgaccgccgtcgccgggatcgtcccggcggcctgg
atgaacaacggccaggcgtgcgtggcccagacccgcatcctcgccccccgctcgcggtac
gaggagatcgccgaggccttcgcggcggcggccggcgcgctggtcgtcggcgacccgctc
gatccggccacccaggtcggcccgctggtggcccagcggcagcagcggcgttcgctcgac
tacatccggatcggccaggacgagggcgccaaggtcctcgcgggcggcggccgcccggcc
gggctcgaccggggctggtacgtcgagccgaccctcttcggcggggtcgacaactccatg
cggatcgcccgcgaggagatcttcggcccggtgatctgcctcctgccgtacggggacgag
gccgaggccctgcggatcgcgaacgactccgacttcgggctcagcggcagcgtctggacc
ggcgacgtggagcacggcgtcgacttcgcccggggcgtccgcacgggcaccttcaacgtc
aacaccttcagcctcgacatgctcggcccgttcggcggctacaagaactccggcctgggc
cgggagttcggccccgagggcctcggcgagtacctggagcacaagatgatccacctgccc
gccggctacgagggcggcgcgtga

DBGET integrated database retrieval system