KEGG   Streptomyces venezuelae: SVEN_2450Help
Entry
SVEN_2450         CDS       T02274                                 

Definition
(GenBank) serine or threonine protein kinase
  KO
K14949  serine/threonine-protein kinase PknG [EC:2.7.11.1]
Organism
sve  Streptomyces venezuelae
Brite
KEGG Orthology (KO) [BR:sve00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sve01001]
    SVEN_2450
Enzymes [BR:sve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SVEN_2450
Protein kinases [BR:sve01001]
 Serine/threonine kinases: Other
  Bacterial family
   SVEN_2450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PknG_TPR PknG_rubred Pkinase TPR_19 Pkinase_Tyr TPR_16 IBR PIP49_C DZR
Motif
Other DBs
NCBI-ProteinID: CCA55736
UniProt: F2R2I7
LinkDB All DBs
Position
2660147..2662753
Genome map
AA seq 868 aa AA seqDB search
MSGETGVVSCQRPSCEGSYEDMGGGELYCDTCGLAPVVAPGGLIGGAPTGVAVPGRGTGT
GTGRGSGVGGPDSGSARSGSRASSRASSRSSTSRRSVSGRLSRSLSGASTSRSVSVRSSG
SSSGQSARNRLGAGLVTIPEVPRPDPRAAVMENPEVPERKRFCSRSDCGAPVGRSRGERP
GRTEGFCTKCGHPYSFVPKLRGGDIVHGQYEVAGCLAHGGLGWIYLAVDRAVSDRWVVLK
GLLDTGDQDAMAAAISERRFLAEIEHSNIVRIYNFVEHLDQRTGSLDGYIVMEYVGGKSL
KEIANDRRTPDGRRDPLPVEQACAYGIEALEALGHLHSRNLLYCDFKVDNAIQSEDQLKL
IDMGAVRRMDDEESAIYGTVGYQAPEVAEVGPSVASDLYTVARTLAVMTFDFQGYTNVFV
DSLPDPDNIEVFRTYESFYRFLVRATDPDPARRFASAQEMAEQLTGVLREVVALQSGRPR
PALSTLFGTEVRVTDTTLFAELTEDVSLLGARRRGRKQTAPPAGPPAVPPAVPATGQPAV
PPAGQPAVPAAGQPAGLAESLAPLDAPATALALPVPRVDPGDPNAGFLAGLAAAAPGELL
AALQAAPAPSAELLLRTLRAQLELGDLPAAAHTLAGLEQRDPDDWRVVWYRGVTSLVTGD
HEHAALAFDAVYDAFPGEPSPKLALGICAEVLGQLDNAAEYYRLVWATDPSFVSAAFGLA
RVRLAAGDRAGAVRTLESVPEASIHYTAARVATVRARLRRRPAWEPLGADLTAAAAQVSA
LQGFGLDAVRRERLSTEVLGTALDWVLSGSPGAEPGGGTLLLGSELDERGLRFGLERSYR
VLARLAQQGEERIELVERANRFRPRTWV
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggggagacgggtgtggtgagctgtcagcgtccttcgtgcgagggttcgtacgag
gacatgggaggcggcgagctgtactgcgacacctgcgggctggccccggtggtcgcgccc
ggaggtctcatcggcggggcgccgacgggggtggcggtcccgggccggggcacgggtacg
ggtacgggcaggggcagcggtgtcggcgggcccgactccggttccgcgcggagcggttcg
cgggcgtcgtcgcgggcgtcgtcgcgttcctcgacctcgcgccgttcggtctcggggcgg
ctctcccgctcgctctccggggcgtccacgtcccgctcggtgtcggtgcgcagctcgggt
tcgtcgtccggccagtccgccaggaaccggctgggcgccggtctggtcacgatccccgag
gtgccgcgtccggaccctcgggcggcggtcatggagaaccccgaggtgcccgagcggaag
cgtttctgctcgcgctccgactgcggtgccccggtgggccgttcgcgcggtgagcggccg
ggccgcaccgagggcttctgcaccaagtgcgggcacccgtactccttcgtgccgaagctg
cgcggcggggacatcgtccacggccagtacgaggtcgcgggctgcctcgcgcacggcggc
ctcggctggatctacctcgccgtcgaccgggccgtctccgaccggtgggtggtcctcaag
ggcctgctcgacaccggggaccaggacgccatggccgcggcgatctcggagcgccgcttc
ctcgccgagatcgagcactccaacatcgtccgcatctacaacttcgtcgagcacctcgac
cagcgcaccggctccctcgacgggtacatcgtcatggagtacgtcggcggcaagtcgctc
aaggagatcgccaacgaccggcgcaccccggacggccggcgcgacccgctgccggtcgag
caggcctgcgcgtacgggatcgaggccctggaggcgctcggacacctgcacagcaggaac
ctgctgtactgcgacttcaaggtcgacaacgccatccagagcgaggaccagctcaagctc
atcgacatgggcgcggtccggcggatggacgacgaggagtccgcgatctacggcacggtc
ggctaccaggcgcccgaggtggccgaggtggggccttcggtggcgagcgacctgtacacg
gtggcgcgcacgctcgcggtgatgaccttcgacttccagggctacacgaacgtcttcgtg
gactcgctgcccgacccggacaacatcgaggtcttccggacgtacgagtcgttctaccgc
ttcctggtccgtgccacggacccggacccggcgcgccggttcgcctccgcgcaggagatg
gccgagcagctgacgggtgtgctgcgggaggtcgtggcgctgcagtcggggcggccgcgg
ccggcgctctcgacgctgttcggcaccgaggtgcgggtcacggacaccacgctgttcgcc
gaactgacggaggacgtgtcgctcctcggcgcccgacgccggggccgcaagcagaccgca
ccaccggccggaccaccggccgtcccgcccgccgtcccggccaccggacagcccgccgtc
ccgcccgccgggcagcccgccgtcccggccgccggacagcccgccgggctcgcggagtcg
ctcgcgccgctggacgcgcccgccaccgcgctcgcgctgcccgtgccgcgcgtcgacccg
ggcgaccccaacgccggattcctcgccggtctcgccgccgccgcgcccggcgaactgctc
gccgcgctccaggccgcccccgcaccctccgccgagctgctgctgcgcaccctccgggcc
cagctggagctgggcgacctgccggccgccgcccacaccctggccggcctcgagcagcgg
gacccggacgactggcgggtcgtctggtaccggggcgtcacctccctggtgaccggggac
cacgagcacgcggcgctcgccttcgacgccgtctacgacgccttccccggcgagccgtcg
ccgaagctggccctcgggatctgcgccgaggtgctcggccagctggacaacgccgccgag
tactaccgcctggtgtgggccaccgacccgagcttcgtcagcgcggccttcgggctcgcc
cgggtgcggctcgcggcgggcgaccgcgccggagccgtacgtaccctcgagtccgtgccg
gaggcctcgatccactacacggcggcccgggtggcgaccgtacgggcgcggctgcggcgg
cgtcccgcgtgggagccgctcggcgccgatctgacggcggccgcggcgcaggtctcggcg
ctccagggcttcggtctggacgcggtgcgccgggagcggttgtcgaccgaggtcctcggg
acggccctcgactgggtactctccgggagtcccggtgcggaaccgggcggcggaacgctg
ctgctcggaagtgaactggacgagcgcggactgcgcttcggcctcgaacgctcgtaccgg
gtgctggcccggctcgcccagcagggcgaggagaggatcgaactggtggagcgggccaac
cgcttccgcccccggacgtgggtgtga

DBGET integrated database retrieval system