KEGG   Streptomyces venezuelae: SVEN_2732Help
Entry
SVEN_2732         CDS       T02274                                 

Definition
(GenBank) serine or threonine protein kinase
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like APH Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: CCA56018
UniProt: F2R4Z7
LinkDB All DBs
Position
complement(2976530..2978281)
Genome map
AA seq 583 aa AA seqDB search
MRPIGSKYLLEEPLGRGATGTVWRARQRETAGAEAAVPGQPGETVAIKVLKEELANDADI
VMRFLRERSVLLRLTHPNIVRTRDLVVEGDVLALVMDLVEGPDLHRYIRDSGPLTPVAAA
LLTAQIADALAASHADGVVHRDLKPANVLLAEQGGQMHPMLTDFGIARLADSPGLTRTHE
FVGTPAYVAPESAEGRPQTSAVDIYGAGILLYELVTGRPPFAGGTALEVLHRHLSEEPRR
PSTVPGPLWTVIERCLSKDPERRPSAVNLARGLRAVAAGIGVHSTPAQIEAAEGVGALLA
PDPAPAPVPETPGAADPTQVLPSGGTPPRYDPAGATSVMPTSGPGGAADPTAVMPPVPSQ
PPQSGQGAQSEEPHPWQSQLRQVRDRNEQTQVQYLDPAQDPLRRRPQRQPQQQPPQDQRP
GQYGQGQQGQQGQYGQQPPPYQQQRPAPQRPQQPYPPQHQQQHQPQQYAPPPPAPQQYAQ
PQQQYTPPQPPPQAPAPRPPRQRSANPVRIPGLGCLKGCLIMIVLFVVAGWLIWELTPLQ
DWIAEGKSYWEAIGDGISTVTDWVSTIGDAADSTGTTGGTPGQ
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
gtgcggcctatcggcagcaagtacctgctcgaggagccgctcggccgcggcgccacgggc
accgtctggcgagcccgccagcgggagacggcgggcgccgaggcggccgtgcccggccag
cccggcgagaccgtggcgatcaaggtcctgaaggaggagctggccaacgacgcggacatc
gtgatgcgcttcctgcgcgagcggtccgtgctgctccggctcacccaccccaacatcgtg
cgcacccgcgacctggtcgtcgagggcgatgtcctcgcgctcgtcatggacctcgtcgag
ggccccgacctgcaccggtacatcagggacagcggcccgctcaccccggtcgccgccgcc
ctcctgaccgcccagatcgccgacgcgctcgccgcgagccacgccgacggcgtcgtccac
cgcgacctgaagccggccaacgtcctgctcgccgagcagggcggccagatgcacccgatg
ctgaccgacttcggcatcgcgcgcctcgcggactccccgggactgacccgcacccacgag
ttcgtgggcacgcccgcgtacgtggcgccggagtccgccgagggccgtccgcagacctcc
gccgtcgacatctacggcgccggcatcctgctctacgagctggtcaccggccggcccccg
ttcgccggcggcaccgcccttgaggtcctgcaccggcacctcagcgaggagccgcgccgg
ccctcgaccgtcccggggccgctgtggacggtcatagagcgctgcctcagcaaggacccc
gagcgccggcccagcgccgtcaacctcgcgcgcggtctgcgcgcggtcgccgcgggcatc
ggcgtgcactccacgcccgcccagatcgaggcggccgagggcgtcggggcgctcctcgcc
ccggaccccgcgcccgcgcccgtgccggagaccccgggcgccgccgacccgacccaggtc
ctgcccagcggcgggacgcccccgcggtacgacccggccggcgccaccagtgtcatgccg
accagcggtccgggcggcgccgccgaccccacggccgtcatgccccccgtgccgtcgcag
ccgccgcagtccgggcagggcgcgcagtccgaggagccgcacccctggcagagccagctg
cgccaggtccgcgaccgcaacgagcagacgcaggtccagtacctggacccggctcaggac
ccgctgcgccgccgcccccagcggcagccgcagcagcagcccccgcaggaccagcggccc
ggccagtacgggcagggccagcagggccagcagggccagtacggccagcagccgccgccg
taccagcagcagcggcccgccccccagcggccgcagcagccgtacccgccgcagcaccag
cagcagcaccagccccagcagtacgcgccgccgccgcccgccccgcagcagtacgcgcag
ccccagcagcagtacaccccgccgcagccgccgccccaggccccggcgccgcgcccgccg
cgtcagcgcagcgccaacccggtgcggatccccggcctcggctgcctcaagggctgcctg
atcatgatcgtgctgttcgtggtcgcgggctggctgatctgggagctcaccccgctccag
gactggatcgccgagggcaagagctactgggaggccatcggcgacggcatctcgacggtg
accgactgggtctccacgatcggcgacgccgccgactccacgggtactaccggcggtacg
ccggggcagtga

DBGET integrated database retrieval system