KEGG   Streptomyces venezuelae: SVEN_2951Help
Entry
SVEN_2951         CDS       T02274                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sve  Streptomyces venezuelae
Pathway
sve00620  Pyruvate metabolism
sve00680  Methane metabolism
sve01100  Metabolic pathways
sve01120  Microbial metabolism in diverse environments
sve01200  Carbon metabolism
Module
sve_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SVEN_2951
  09102 Energy metabolism
   00680 Methane metabolism
    SVEN_2951
Enzymes [BR:sve01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SVEN_2951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Haemocyan_bet_s
Motif
Other DBs
NCBI-ProteinID: CCA56237
UniProt: F2R7F2
LinkDB All DBs
Position
complement(3224098..3226827)
Genome map
AA seq 909 aa AA seqDB search
MSSADQTPTASAELRADIRRLGDLLGETLVRQEGHELLDLVERVRSLTREDGEAAAELLR
GVELETAAKLVRAFSTYFHLANVTEQVHRGREMREKRAAEGGLLARTADMLKDGDPEHVR
ETVKNLNVRPVFTAHPTEAARRSVLNKLRRIGALLETPVIEADRRRHDLRLAENIDLIWQ
TDELRVVRPEPADEARNAIYYLDELHAGAVGDVLEDLAAELERVGFELPSGTRPLTFGTW
IGGDRDGNPNVTPQVTWDVLILQHEHGITDALELVDFLRGLLSNSIRYAGATQELLDSLQ
RDLELLPEISPRYKRLNAEEPYRLKATCIRQKLVNTRERLASGTPHQDGRDYLGTAELVH
DLTLIQTSLREHRGGLFADGRMDRTIRTLSAFGLQLATMDVREHADAHHHTLGQLFDRLG
EESWRYADMPRDYRQKLLAKELRSRRPLAPTPAPLDAAGEKTLGVFHTIKQAFERFGPEV
IESYIISMCQGADDVFAAAVLAREAGLIDLHAGWAKIGIVPLLETTDELKAADVILDGML
ADPSYRRLVSLRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRYGVRLRLFH
GRGGTVGRGGGPSHDAILAQPWGTLEAEIKVTEQGEVISDKYLIPSLARENLELTVAATL
QASALHTAPRQSDEALARWDAAMDVVSDAAHAAYRRLVEDPDLPTYFLASTPVDQLADLH
LGSRPSRRPGSGVSLDGLRAIPWVFGWTQSRQIVPGWFGVGSGLKALREAGLDAVLGEMH
ERWHFFRNFLSNVEMTLAKTDLRIARHYVDTLVPDELKHVFDTIEAEHALTVAEVLKVTG
GEKLLDSNPVLQQTFAIRDAYLDPISYLQVALLARQRGAAERGEEPDPLLARALLLTVNG
VAAGLRNTG
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgaccagacccccaccgccagcgccgagctgcgcgccgacatccgccga
ctgggcgacctcctcggcgagacactcgtccgccaggagggccacgaactcctcgacctc
gtcgagcgggtccgcagcctcacccgcgaggacggcgaggcagccgccgagctgctccgc
ggcgtcgaactggagaccgccgccaagctggtgcgcgccttctccacctacttccacctc
gcgaacgtcaccgagcaggtccaccgcggccgcgagatgcgcgagaagcgcgccgccgag
ggcggcctgctcgcccgcaccgccgacatgctcaaggacggcgaccccgagcacgtccgc
gagacggtcaagaacctcaacgtccggcccgtcttcaccgcgcaccccaccgaagccgcc
cgccgctccgtcctcaacaagctgcgccgcatcggcgccctcctggagaccccggtcatc
gaggccgaccggcgccgccacgacctgcggctcgccgagaacatcgacctcatctggcag
accgacgaactccgggtggtccgccccgagcccgccgacgaggcccgcaacgccatctac
tacctcgacgagctgcacgccggcgccgtcggcgacgtcctggaggacctcgccgccgaa
ctggagcgcgtcggcttcgaactgccctccggcacccgcccgctcaccttcggcacctgg
atcggcggcgaccgcgacggcaaccccaacgtcaccccgcaggtgacctgggacgtcctg
atcctccagcacgagcacggcatcaccgacgccctcgaactcgtcgacttcctgcgcggc
ctgctctccaactccatccgctacgccggagccacccaggaactcctggactccctccag
cgcgacctggagctcctcccggagatcagcccccgctacaagcgcctcaacgccgaggag
ccgtaccgcctcaaggccacctgcatccggcagaagctcgtcaacacccgcgagcgcctc
gcctccggcaccccccaccaggacggccgcgactacctcggcaccgccgagctcgtccac
gacctgaccctcatccagacctcgctgcgcgagcaccgcggcggcctgttcgccgacggc
cggatggaccgcaccatccgcaccctctcggccttcggcctccagctcgccaccatggac
gtccgcgagcacgccgacgcccaccaccacaccctcgggcagctcttcgaccgcctcggc
gaggagtcctggcggtacgccgacatgccgcgcgactaccggcagaagctgctcgccaag
gagctccgctcgcgccgtccgctcgcccccaccccggccccgctcgacgccgccggcgag
aagaccctcggcgtcttccacaccatcaagcaggccttcgagcgcttcggccccgaggtc
atcgagtcgtacatcatctcgatgtgccagggcgccgacgacgtcttcgccgccgccgtc
ctcgcccgcgaggccggcctgatcgacctccacgccggctgggccaagatcggcatcgtg
ccgctcctggagaccaccgacgagctgaaggccgccgacgtcatcctcgacggcatgctc
gccgacccctcctaccggcgcctcgtctcgctccgcggcgacgtccaggaggtcatgctg
ggctactcggactcctccaagttcggcggcatcaccacctcccagtgggagatccaccgt
gcccagcgcaggctccgcgacgtcgcccaccgctacggcgtacggctccgcctcttccac
ggccgcggcggcaccgtcggccgcggcggcggcccctcgcacgacgcgatcctcgcgcag
ccctggggcaccctggaggccgagatcaaggtgaccgagcagggcgaggtcatctccgac
aagtacctcatcccgtccctcgcgcgggagaacctcgaactgaccgtcgccgccaccctg
caggcctccgccctgcacaccgcgccgcgccagtccgacgaggccctcgcccgctgggac
gcggccatggacgtcgtctccgacgccgcccacgccgcctaccgccgcctcgtcgaggac
cccgacctgccgacgtacttcctcgcgtcgacgccggtggaccagctcgccgacctgcac
ctgggctcccggccctcccgccgccccggctccggcgtctccctcgacggactgcgggcc
atcccgtgggtgttcggctggacccagtcccggcagatcgtccccggctggttcggcgtc
ggctccggcctcaaggccctgcgcgaggccggcctcgacgcggtcctgggcgagatgcac
gagcggtggcacttcttccgcaacttcctctccaacgtcgagatgacgctcgcgaagacg
gacctgcggatcgcccgccactacgtcgacaccctcgtccccgacgagctcaagcacgtc
ttcgacaccatcgaggccgagcacgcgctgaccgtcgccgaggtcctcaaggtcaccggc
ggcgagaagctcctggactccaacccggtcctccagcagaccttcgccatccgcgacgcc
tacctggacccgatctcctacctccaggtcgccctgctcgcccgccagcgcggcgccgcc
gagcgcggcgaggagcccgacccgctgctcgcccgggcgctgctgctcacggtgaacggc
gtggccgcgggcctgcgcaacaccggctga

DBGET integrated database retrieval system