KEGG   Streptomyces venezuelae: SVEN_3723Help
Entry
SVEN_3723         CDS       T02274                                 

Definition
(GenBank) putative oxidoreductase
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 Abhydrolase_1 Abhydrolase_6 Hydrolase_4 KR Epimerase AXE1
Motif
Other DBs
NCBI-ProteinID: CCA57009
UniProt: F2RDB3
LinkDB All DBs
Position
complement(4043250..4045043)
Genome map
AA seq 597 aa AA seqDB search
MAGLEGARERWVRTGGIELCVAELGERGRPTVVLVHGYPDSKEVWSEVAVRLAEDFHVVL
YDVRGHGRSTAPAPLRGGFTLEKLTDDFLAVADAVSPDRPVHLVGHDWGSVQSWEFVTVR
RTEGRIASFTSMSGPSLDHFGHWIKQRMTRPTPRRVGQLLGQGAKSWYVYMLHTPVLPEL
AWRGPLGRRWPKILERVEKVPAGAYPTPSLPSDAAHGAWLYRDNVRARLGRPRPDAFAHV
PVQLITPTGDAFLSERLYDDLGSWAPDLTRRTLPAKHWVPRTRPDQLSAWIGEFVRANEE
PATKAPKPVAATAVKSGVKPAHAERFGGQLVLVTGAASGIGRATAFAFAEAGARVVAVDR
DAEGAVRTAEMARLIGAPEAWGETVDVADEQAMEKLAAKVASEYGVVDVLVNNAGIGLTG
SFFDTTSEEWKRVLDVNLWGVIHGCRVFGAQMTARGQGGHIVNTASAAAFQPSRALPAYS
TSKAAVLMLSECLRAELAGQGIGVSAICPGIVNTNITATTRFAGVSDAGEEKRRQTKASR
LYGLRNFPPEKVADAILDAVLHDRAVVPVTPEARGVHFLSRLSPGTLRAFARWQPPA
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggcagggctcgagggagcgcgggagcgctgggtccgtacgggcgggatagagctgtgt
gtcgccgagctcggcgagcggggccggcccaccgtcgtcctcgtgcacgggtacccggac
tccaaggaggtctggtcggaggtcgcggtccggctcgccgaggacttccacgtggtgctc
tacgacgtgcggggccacggccgttcgaccgcgcccgccccgctgcgcggcggcttcacc
ctggagaagctgacggacgacttcctcgcggtcgccgacgccgtcagcccggaccggcca
gtccacctcgtcggtcacgactggggatcggtgcagtcctgggaattcgtcaccgtccgg
cgcaccgagggccgcatcgcgtccttcacctcgatgtcggggccgtccctcgaccacttc
gggcactggatcaagcagcggatgacccggcccaccccgcgccgggtcggtcagctcctc
ggccagggcgccaagtcctggtacgtgtacatgctgcacacgcccgtgctgccggagctc
gcctggcgcggcccgctcggcaggcggtggccgaagatcctggagcgcgtcgagaaggtc
ccggccggcgcgtacccgacgccgtcgctgccgagcgacgcggcgcacggcgcctggctc
taccgggacaacgtccgcgcccgtctcggcaggccgcgccccgacgcgttcgcgcacgtg
cccgtgcagctgatcacgccgaccggtgacgccttcctctccgagcggctctacgacgac
ctgggcagctgggcgcccgatctgacccggcgcacgctgcccgccaagcactgggtgccg
cgcacccggccggaccagctgtccgcgtggatcggcgagttcgtccgggccaacgaggaa
ccggcgaccaaggcgccgaagccggtcgcggcgacggcggtgaagagcggtgtgaagccg
gcccacgcggagcggttcggcggccagctggtcctggtgaccggggcggccagcggcatc
gggcgggccaccgcgttcgccttcgccgaggccggcgcccgggtcgtggccgtcgaccgg
gacgccgaaggggcggtcaggacggccgagatggcccggctgatcggcgccccggaggcc
tggggcgagacggtggacgtcgccgacgagcaggcgatggagaagctcgccgccaaggtc
gcgagcgagtacggcgtcgtcgacgtcctcgtcaacaacgcgggcatcgggctcaccggc
tccttcttcgacacgacgagcgaggagtggaagcgggtcctggacgtcaatctgtggggt
gtgatccacggctgccgggtcttcggggcgcagatgaccgcgcgcggccagggcggccac
atcgtcaacaccgcctccgcggccgccttccagccttcccgcgccctgcccgcgtacagc
acgtcgaaggcggcggtgctgatgctcagcgagtgtctgcgcgccgaactggcgggccag
ggcatcggggtgtccgcgatatgccccggcatcgtcaacaccaacatcacggcgaccacg
cggttcgccggagtgtcggacgcgggggaggagaagcggcgccagacgaaggcgtcccgg
ctgtacggcctgcggaacttcccgccggagaaggtcgccgacgcgatcctggacgcggtg
ctgcacgaccgcgcggtcgtgccggtgacgcccgaggcccggggcgtgcacttcctgtcc
cggctcagcccgggaacgctgcgggccttcgcccggtggcagccgccggcgtag

DBGET integrated database retrieval system