KEGG   Streptomyces venezuelae: SVEN_4458Help
Entry
SVEN_4458         CDS       T02274                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sve  Streptomyces venezuelae
Pathway
sve00564  Glycerophospholipid metabolism
sve01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sve00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SVEN_4458
Enzymes [BR:sve01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SVEN_4458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: CCA57744
UniProt: F2RK10
LinkDB All DBs
Position
4798400..4800106
Genome map
AA seq 568 aa AA seqDB search
MRTATLGPAERIEALAGMAERELDVLVVGAGVVGAGTALDAVTRGLSTGIVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLERLAPHLVKPVPFLYPLQHKGWERFY
AGSGVALYDAMSLSSGHGRGLPVHRHLSRRGALRVAPCLRKDALVGALQYYDAQMDDARF
VTTLVRTAASYGALAASRARVTGFLREGARVVGARVQDVEAGAAYEIRAKQIVNATGVWT
DDTQALIGERGQFHVRASKGIHLVVPKDRIHSTTGLILRTEKSVLFVIPWGRHWIVGTTD
TEWDLDKAHPAASSADIDYLLEHVNTVLATPLTRDDVEGVYAGLRPLLAGESDATSKLSR
EHTVAHPVPGLVVVAGGKYTTYRVMAKDAVDEAVHGLDQRVAPCVTEDTPLLGAEGYRAL
WNARARIAARTGLHVVRVEHLLNRYGSLTEQILALIAEDPTLGEPLEAADDYLRAEIVYA
ASHEGARHLDDVLTRRTRISIETFDRGTRSARVCAELMAPVLGWDEHQIDKEVEHYEKRV
EAERESQRQPDDLTADAARLGAPDIVPI
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacagcgacactgggacccgccgagcgcatcgaggcgctcgcgggcatggccgag
cgcgagctggacgtgctggtcgtgggcgccggcgtggtcggcgcgggcacggccctcgac
gccgtcacgagaggactctccaccggcatcgtcgaggcccgcgactgggcctccggcacc
tccagccggtccagcaagctcatccacggcggcctgcgctacctggagatgctggacttc
gccctggtcagagaggcactcaaggagcgcggactgctccttgagcggctcgcaccccat
ttggtgaagcccgtccccttcctctacccgctccaacataagggctgggagcggttctac
gcgggctccggcgtcgcgctgtacgacgcgatgtcgctctcctcagggcacggccgcggc
ctccccgtccaccgccacctctcccggcgcggcgccctgcgcgtcgccccctgcctccgg
aaggacgccctcgtcggcgccctccagtactacgacgcccagatggacgacgcccgcttc
gtcaccaccctcgtgcgcaccgccgcctcctacggcgcgctggccgccagccgggcccgg
gtgaccggcttcctccgcgagggcgcgcgggtcgtcggcgcccgcgtccaggacgtcgag
gccggagcggcgtacgagatcagggccaaacagatcgtgaacgccaccggggtgtggacc
gacgacacccaggccctcatcggcgagcgcggccagttccacgtccgcgcctccaagggc
atccacctcgtcgtccccaaggaccgcatccactcgactaccgggctcatcctgcgcacc
gagaagtccgtgctcttcgtgatcccctggggccggcactggatcgtcggcaccaccgac
accgagtgggacctcgacaaggcccaccccgccgcgtccagcgccgacatcgactatctg
ctcgaacacgtgaacaccgtgctcgccaccccgctcacccgggacgacgtcgagggcgtc
tacgccggcctgaggccgctgctcgccggcgagtcggacgccacgagcaagctctcccgc
gagcacaccgtcgcccacccggtccccggcctggtcgtggtggccggcggcaagtacacg
acgtaccgcgtcatggccaaggacgccgtcgacgaggcggtgcacggcctcgaccagcgg
gtcgccccctgcgtcaccgaggacaccccgctcctgggcgccgagggctaccgcgccctg
tggaacgcgcgggcgagaatcgccgcgcggaccggactgcacgtcgtccgggtcgagcat
ctcctcaaccggtacggctccctgacggagcagatcctcgccctcatcgccgaggacccc
acgctcggcgaaccgctggaggccgccgacgactacctgcgcgccgaaatcgtctacgcg
gcctcgcacgagggcgcgcgccacctcgacgacgtcctcacccggcggaccaggatctcc
atcgagaccttcgaccggggcacgcgcagcgcccgggtgtgcgcggagctgatggccccg
gtcctcggctgggacgagcaccagatcgacaaggaggtggagcactacgagaagcgggtc
gaggcggagcgcgagtcgcagcggcagcccgacgacctcacggcggacgccgcgcggctc
ggggcgccggacatcgtgccgatctga

DBGET integrated database retrieval system