KEGG   Streptomyces venezuelae: SVEN_4531Help
Entry
SVEN_4531         CDS       T02274                                 

Definition
(GenBank) Succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
sve  Streptomyces venezuelae
Pathway
sve00020  Citrate cycle (TCA cycle)
sve00190  Oxidative phosphorylation
sve00650  Butanoate metabolism
sve01100  Metabolic pathways
sve01110  Biosynthesis of secondary metabolites
sve01120  Microbial metabolism in diverse environments
sve01130  Biosynthesis of antibiotics
sve01200  Carbon metabolism
Module
sve_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sve_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sve_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SVEN_4531
   00650 Butanoate metabolism
    SVEN_4531
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SVEN_4531
Enzymes [BR:sve01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SVEN_4531
    1.3.5.4  fumarate reductase (quinol)
     SVEN_4531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4_9 Fer4_16 Fer4 Fer4_4 Fer4_18 Fer4_6 Fer4_2 Fer4_3 Fer4_21 Fer4_15
Motif
Other DBs
NCBI-ProteinID: CCA57817
UniProt: F2RL58
LinkDB All DBs
Position
complement(4884811..4885569)
Genome map
AA seq 252 aa AA seqDB search
MATPVLDKVEKDSAASPYITVTMRIRRFNPEVSDASVWEDFQIEIDPKERVLDALHKIKW
DVDGTLTFRRSCAHGICGSDAMRINGKNRLACKTLIKDINPEKPITVEAIKGLTVLKDLV
VDMEPFFQAYRDVMPFLVTKGNEPTRERLQSAEDRERFDDTTKCILCAACTSSCPVFWND
GQYFGPAAIVNAHRFIFDSRDEAGEQRLEILNDKDGVWRCRTTFNCTDACPRGIEVTKAI
QEVKRALITRRF
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggctacccccgtactggacaaggtggagaaggactccgcggcctccccgtacatcacg
gtcacgatgcggatccgccgcttcaaccccgaggtgtcggacgcgtcggtctgggaggac
ttccagatcgagatcgacccgaaggagcgcgtgctcgacgccctccacaagatcaagtgg
gacgtcgacggcaccctgaccttccgccgctcgtgcgcgcacggcatctgcggctcggac
gcgatgcggatcaacggcaagaacaggctcgcctgcaagacgctgatcaaggacatcaac
cccgagaagccgatcacggtcgaggccatcaagggcctcacggtcctcaaggacctcgtg
gtcgacatggagccgttcttccaggcgtaccgggacgtcatgccgttcctggtcaccaag
ggcaacgagccgacgcgcgagcgcctgcagtccgccgaggaccgcgagcgcttcgacgac
accaccaagtgcatcctgtgcgccgcgtgcacgtcgtcctgcccggtcttctggaacgac
ggccagtacttcggtccggccgcgatcgtcaacgcgcaccgcttcatcttcgactcgcgt
gacgaggccggtgagcagcgcctggagatcctgaacgacaaggacggcgtgtggcgttgc
cgcacgacgttcaactgcaccgacgcctgcccgcgtggcatcgaggtcaccaaggccatc
caggaagtgaagcgcgcgctgatcacgcgtcgtttctga

DBGET integrated database retrieval system