KEGG   Streptomyces venezuelae: SVEN_4532Help
Entry
SVEN_4532         CDS       T02274                                 

Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sve  Streptomyces venezuelae
Pathway
sve00020  Citrate cycle (TCA cycle)
sve00190  Oxidative phosphorylation
sve00650  Butanoate metabolism
sve01100  Metabolic pathways
sve01110  Biosynthesis of secondary metabolites
sve01120  Microbial metabolism in diverse environments
sve01130  Biosynthesis of antibiotics
sve01200  Carbon metabolism
Module
sve_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sve_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sve_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SVEN_4532
   00650 Butanoate metabolism
    SVEN_4532
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SVEN_4532
Enzymes [BR:sve01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SVEN_4532
    1.3.5.4  fumarate reductase (quinol)
     SVEN_4532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 DAO HI0933_like Pyr_redox_2 FAD_oxidored Pyr_redox_3 GIDA
Motif
Other DBs
NCBI-ProteinID: CCA57818
UniProt: F2RL59
LinkDB All DBs
Position
complement(4885569..4887323)
Genome map
AA seq 584 aa AA seqDB search
MKIHKYDTVIVGAGGAGMRAAIEATKRSRTAVLTKLYPTRSHTGAAQGGMAAALANVEED
NWEWHTFDTVKGGDYLVDQDAAEILAKEAIDAVLDLEKMGLPFNRTPNGTIDQRRFGGHS
RNHGEAPVRRSCYAADRTGHMILQTLYQNCVKEGVEFFNEFYVLDQLITEIDGVKHSAGV
VAYELATGEIHIFQAKAVIYASGGTGKFFKVTSNAHTLTGDGQAACYRRGLPLEDMEFFQ
FHPTGIWRMGILLTEGARGEGGILRNKDGERFMEKYAPVMKDLASRDVVSRSIYTEIREG
RGCGPEGDHVYLDLTHLPPEQLDAKLPDITEFARTYLGIEPYTDPIPIQPTAHYAMGGIP
TNVEGEVLSDNTTVVPGLYAAGEVACVSVHGANRLGTNSLLDINVFGKRSGIAAAEYSAK
HDFVELPENPESLVVAQIEKLRNSTGSERVADLRRELQETMDANVMVFRTEQTIKTAVEK
IAELRERYENVSIQDKGKRFNTDLLEAIELGNLLELAEVMAVSALARKESRGGHYREDYP
NRDDVNFMRHTMAYREVGEDGSETVRLDYKPVVTTRYQPMERKY
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccacaagtacgacaccgtcatcgtcggcgccggcggcgccggcatgcgcgcc
gccatcgaggcgacgaagcgcagccgcaccgccgtgctgacgaagctctaccccacccgc
tcccacacgggcgccgcgcagggcggcatggccgccgcgctggcgaacgtggaggaggac
aactgggagtggcacaccttcgacacggtcaagggcggtgactacctggtcgaccaggac
gccgccgagatcctggcgaaggaggccatcgacgccgtcctcgacctggagaagatgggc
ctgccgttcaaccgcaccccgaacggcaccatcgaccagcgccgcttcggcggccactcc
cgcaaccacggcgaggcgccggtccgccggtcctgctacgccgcggaccgcaccggccac
atgatcctccagacgctgtaccagaactgcgtcaaggagggcgtggagttcttcaacgag
ttctacgtcctggaccagctgatcaccgagatcgacggggtgaagcactccgcgggcgtc
gtcgcctacgagctggccaccggcgagatccacatcttccaggccaaggccgtcatctac
gcctccggcggcaccggcaagttcttcaaggtgacctccaacgcccacaccctgaccggt
gacggccaggccgcgtgctaccgccgcggtctgccgctggaggacatggagttcttccag
ttccacccgacgggcatctggcgcatgggcatcctgctgacggagggcgcccgcggtgag
ggcggcatcctccgcaacaaggacggcgagcgcttcatggagaagtacgcgccggtcatg
aaggacctcgcgtcccgtgacgtcgtctcccgctccatctacacggagatccgcgagggc
cgcggctgcggtcccgagggcgaccacgtctacctggacctgacgcacctcccgccggag
cagctcgacgccaagctcccggacatcaccgagttcgcccgtacgtacctcggcatcgag
ccgtacacggacccgatcccgatccagcccaccgcgcactacgccatgggcggcatcccg
accaacgtcgagggtgaggtcctctcggacaacaccaccgtcgtccccggtctgtacgcc
gccggcgaggtcgcctgcgtgtcggtgcacggcgccaaccgcctgggcaccaactcgctg
ctcgacatcaacgtcttcggcaagcgctccggcatcgccgccgccgagtactccgccaag
cacgacttcgtcgagctgccggagaacccggagtccctcgtcgtcgcgcagatcgagaag
ctgcgcaactccacgggcagcgagcgggtcgccgacctgcgccgtgagctccaggagacg
atggacgccaacgtgatggtgttccgcacggagcagaccatcaagacggccgtcgagaag
atcgccgagctccgcgagcgctacgagaacgtgtccatccaggacaagggcaagcgcttc
aacacggacctcctggaggccatcgagctgggcaacctgctcgaactggccgaggtcatg
gccgtctcggccctggcgcgcaaggagtcccgcggcggtcactaccgcgaggactacccg
aaccgcgacgacgtcaacttcatgcgtcacaccatggcgtaccgcgaggtcggcgaggac
ggctccgagaccgtccgtctcgactacaagccggtcgtgacgacccgctaccagccgatg
gagcgtaagtactga

DBGET integrated database retrieval system