KEGG   Streptomyces venezuelae: SVEN_4944Help
Entry
SVEN_4944         CDS       T02274                                 

Definition
(GenBank) Nickel-dependent superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
sve  Streptomyces venezuelae
Brite
KEGG Orthology (KO) [BR:sve00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SVEN_4944
Enzymes [BR:sve01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SVEN_4944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni HSR
Motif
Other DBs
NCBI-ProteinID: CCA58230
UniProt: F2R2V5
LinkDB All DBs
Position
complement(5318100..5318495)
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVKVSAHCDLPCGVYDPAQARIEAESVKAVQEKYLANEDAHFRARATVIKEQ
RAELAKHHVSVLWSDYFKAPHFEKYPELNQLVNDTLKALSAAKASTDPKTGEKALELIAE
IDRIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctctcccgcctgtttgcccccaaggtgaaggtcagcgcccactgcgacctcccgtgc
ggcgtgtacgacccggcccaggcccgcatcgaggccgagtccgtcaaggctgtccaggag
aagtacctggccaacgaggacgcgcacttccgcgcccgcgccacggtcatcaaggagcag
cgcgcggagctcgccaagcaccacgtctcggtgctctggagcgactacttcaaggccccg
cacttcgagaagtaccccgagctcaaccagctggtcaacgacaccctgaaggccctctcg
gccgccaaggcgtcgacggacccgaagacgggcgagaaggcgctggagctcatcgccgag
atcgaccgcatcttctgggagaccaagaaggcctga

DBGET integrated database retrieval system