KEGG   Streptomyces venezuelae: SVEN_5126
Entry
SVEN_5126         CDS       T02274                                 

Definition
(GenBank) 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonatesynthase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
sve  Streptomyces venezuelae
Pathway
sve00997  Biosynthesis of various secondary metabolites - part 3
sve01100  Metabolic pathways
sve01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sve00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    SVEN_5126
Enzymes [BR:sve01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     SVEN_5126
SSDB
Motif
Pfam: DeoC NMO
Other DBs
NCBI-ProteinID: CCA58412
UniProt: F2R440
LinkDB
Position
complement(5532129..5533115)
AA seq 328 aa
MTGFGHFARSLRLRRLYRHSTAGLMITPLDHSIHDGPVVPKGTTLDQLAAKIASGGADAV
VVHKGSVRHISPERFAAMSLIIHLNASTSQALDPNAKYVVAGVEEALRLGADAVSVHVNL
GSDDERQQIGDLGRIADACDRWNLPLLAMVYPRGPRITDPRDPAVVAHAVTIAADLGADL
VKTVFLGSTAEMLDLTAACPVPVLVAGGPALEKEEDVLAYVRDAIAGGAGGVAMGRNIFQ
AKDPRALAAKVARVVHHFPEQHFTTGPFSEAAGRERLHGERLTPDHLDGTPLDDPHHDTT
HLDPSLDGSSLDNLTGGPHHDGRQTVLA
NT seq 987 nt   +upstreamnt  +downstreamnt
atgaccggtttcggccacttcgcccggtcgctgcggctacggcggctctaccgccacagc
acggccggcctgatgatcacccctctcgaccactcgatccatgacggtcccgtggtcccg
aagggcaccaccctcgaccagctcgccgccaagatcgcctccggcggcgccgacgccgtc
gtcgtccacaagggcagcgtgcggcacatcagcccggagcggttcgccgcgatgtcgctg
atcatccatctcaacgcgagcaccagccaggcgctcgaccccaacgccaagtacgtcgtc
gccggcgtcgaagaggccctccgcctcggcgcggacgcggtcagcgtccacgtcaacctc
ggctccgacgacgagcggcagcagatcggcgacctcggccggatcgccgacgcctgcgac
cgctggaacctgccgctgctcgccatggtgtacccgcgggggccgcggatcaccgacccc
cgggacccggccgtcgtcgcgcacgccgtgacgatcgccgcggacctgggcgcggacctg
gtcaagaccgtcttcctcggatccaccgcggagatgctcgacctgaccgcggcctgcccg
gtgccggtgctggtggccggcggacccgccctggagaaggaggaggacgtcctcgcgtac
gtcagggacgccatcgccggaggggcgggcggggtggccatgggccgcaacatcttccag
gccaaggacccgcgggcgctggcggcgaaggtcgccagggtcgtgcaccacttccccgaa
cagcacttcaccaccggcccgttcagcgaggcggccggacgggagcggcttcacggcgaa
cgcctcacccccgaccacctcgacggcacaccgctcgacgacccgcaccacgacaccacg
cacctcgacccgtcgctcgacggttcgtcactcgacaacctgacaggaggtccgcatcat
gacggacgccaaactgtgctggcttga

DBGET integrated database retrieval system