KEGG   Streptomyces venezuelae: SVEN_6165Help
Entry
SVEN_6165         CDS       T02274                                 

Definition
(GenBank) putative aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sve  Streptomyces venezuelae
Pathway
sve00250  Alanine, aspartate and glutamate metabolism
sve00410  beta-Alanine metabolism
sve00640  Propanoate metabolism
sve00650  Butanoate metabolism
sve01100  Metabolic pathways
sve01120  Microbial metabolism in diverse environments
Module
sve_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SVEN_6165
   00650 Butanoate metabolism
    SVEN_6165
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SVEN_6165
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SVEN_6165
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sve01007]
    SVEN_6165
Enzymes [BR:sve01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SVEN_6165
Amino acid related enzymes [BR:sve01007]
 Aminotransferase (transaminase)
  Class III
   SVEN_6165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: CCA59451
UniProt: F2RDF9
LinkDB All DBs
Position
6719933..6721213
Genome map
AA seq 426 aa AA seqDB search
MSELFDRHKAVIPDWVALYYRDPIEITHGEGRHVWDAEGRRYLDFFGGILTTMTAHALPE
VTKAVSEQAGRIIHSSTLYLNRPMVELAERIAGLSGIPDARVFFTTSGTEANDAALLLAT
AYRRSNQILAMRNSYHGRSFSTVGITGNRAWSPTGLSPLQTLYVHGAVRTRGPYAQYTDE
RFIDACVDDLEDLLGHTRDVAALIAEPIQGVGGFTAPPDGLYAAFRRVLDRHGILWISDE
VQTGWGRTGDHFWGWQAHGQAGPPDILTFAKGIGNGMSVGGVVARAEIMNCLDANSISTF
GGSPITMAAGLANLSYLLEHDLQGNARRVGGLLIERIRAACAGIPAVREVRGRGLMIGIE
LTEPDTDRADPDAAAAVLEAARENGLLIGKGGGHNTSTLRVAPPLSLTVAEAEEGAAMLE
QALREL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagctcttcgaccggcacaaggccgtcatccccgactgggtcgccctctactac
cgggaccccatcgagatcacccacggcgagggccgccacgtctgggacgccgaaggacgc
cgctacctggacttcttcggcggcatcctcaccaccatgaccgcccacgccctgcccgag
gtcaccaaggccgtctccgagcaggccgggcggatcatccactcctcgacgctctacctc
aaccggcccatggtggagctcgccgagcggatcgccggcctctccggcatccccgacgcc
cgggtcttcttcaccacctccggcaccgaggccaacgacgcggcgctgctcctcgccacc
gcgtaccgccgctcgaaccagatcctggcgatgcggaacagctaccacggccgttccttc
tccaccgtcggcatcaccggcaaccgggcctggtcgccgaccggcctctcgccgctgcag
accctgtacgtgcacggcgccgtccgcacccgcggcccgtacgcgcagtacaccgacgaa
cggttcatcgacgcctgcgtcgacgacctcgaagacctcctcggccacacccgggacgtc
gccgcgctgatcgccgaacccatccagggagtcggcggcttcaccgccccgcccgacggc
ctgtacgccgccttccgccgggtcctcgaccggcacggcatcctgtggatctccgacgag
gtgcagaccggctggggccgtaccggcgaccacttctggggctggcaggcgcacggccag
gccgggccgcccgacatcctcaccttcgccaagggcatcggcaacggcatgtccgtcggc
ggggtcgtcgcccgcgccgagatcatgaactgcctcgacgccaactcgatctccacgttc
ggcggttcgcccatcaccatggccgccgggctcgccaacctctcgtacctcctggagcac
gacctccagggcaacgcccgccgggtcggcggcctgctcatcgagcggatcagggccgcg
tgcgctggtatccccgcggtccgcgaggtacgcggccgcggtctcatgatcggcatcgag
ctcaccgaaccggacaccgaccgggccgatccggacgcggccgccgcggtcctggaggcc
gcccgtgagaacggcctgctgatcggcaagggcggcggccacaacaccagcaccctccgc
gtcgccccaccgctctcgctcaccgtcgccgaggcggaggagggcgcggcgatgctcgaa
caggccctgcgagagctgtag

DBGET integrated database retrieval system