KEGG   Streptomyces venezuelae: SVEN_6394Help
Entry
SVEN_6394         CDS       T02274                                 

Definition
(GenBank) ATP-dependent DNA ligase LigC
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C Lipase_GDSL_2
Motif
Other DBs
NCBI-ProteinID: CCA59680
UniProt: F2REZ5
LinkDB All DBs
Position
complement(6978911..6980023)
Genome map
AA seq 370 aa AA seqDB search
MPVSLGLADKSRIPDNRLMDLPVMPPVKPMLAKSVKRIPPGMQYEAKWDGFRAIVHRDGP
ELVIGSRTGKPLTRYFPELVEALAARLPERCVVDGEIVIEHEGHLDFDRLSERIHPADSR
VRMLAETTPARFVAFDLLALGDDALLDTPLSERRATLERVFAGVDAPVHLAPATHDPELA
ARWFDQYEGAGLDGVIAKPLDLPYRPDARLMYKIKHERTADVVVAGYRFHKSGPVVGSLL
LGLYDDKGALQHVGVCAAFTARRRAELIEELEPLRMDPPDGHPWAAWAEEAAHAGARLPG
APSRWSGKKDLSWVALRPERVCEVGYDHMEGDRFRHTAQFKRWRPDRTPESCGYGQLDEP
VSYDLSEILG
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgccggtcagcctagggctcgccgacaagtcccgcataccggacaatcgcctcatggat
cttccggtgatgccgcccgtgaaaccgatgctcgccaagtccgtgaagcggatcccgccc
gggatgcagtacgaggcgaagtgggacggcttccgcgcgatcgtgcaccgggacgggccg
gagctcgtcatcggcagccgtaccggcaaacccctcacccggtacttccccgagctggtc
gaggccctcgcggcccggctgccggagcgctgcgtggtcgacggcgagatcgtcatcgag
cacgaggggcacctcgacttcgaccggctcagcgagcggatccacccggcggactcccgg
gtccgcatgctggccgagaccaccccggcccggttcgtcgccttcgacctgctggccctc
ggggacgacgccctgctcgacaccccgctgagcgagcggcgggcaaccctggagcgggtc
ttcgccggcgtcgacgccccggtccacctggccccggcgacccatgaccccgagctcgcc
gcgcgctggttcgaccagtacgagggcgcgggcctcgacggggtgatcgccaaaccgctc
gacctgccctaccggccggacgcccgcctcatgtacaagatcaagcacgagcggacggcg
gacgtcgtcgtggccggctaccgcttccacaagagcggaccggtggtcggctcgctgctg
ctcggcctgtacgacgacaagggcgccctccagcacgtcggcgtgtgcgcggcgttcacc
gcgcggcggcgcgccgagctgatcgaggagctcgagccgctccggatggacccgccggac
gggcacccgtgggcggcctgggcggaggaggccgcgcacgccggcgcgcgactgccgggg
gcgccgagccgctggtcggggaagaaggacctgtcgtgggtggcgctgcggcccgagcgg
gtctgcgaggtggggtacgaccacatggagggcgaccgcttccgccacacggcgcagttc
aagcggtggcgcccggaccggacgccggagtcctgcgggtacgggcagctggacgagccc
gtctcgtacgacctgtcggagatcctcggctag

DBGET integrated database retrieval system