KEGG   Streptomyces venezuelae: SVEN_7275Help
Entry
SVEN_7275         CDS       T02274                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sve  Streptomyces venezuelae
Pathway
sve03030  DNA replication
sve03410  Base excision repair
sve03420  Nucleotide excision repair
sve03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sve00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SVEN_7275
   03410 Base excision repair
    SVEN_7275
   03420 Nucleotide excision repair
    SVEN_7275
   03430 Mismatch repair
    SVEN_7275
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sve03032]
    SVEN_7275
   03400 DNA repair and recombination proteins [BR:sve03400]
    SVEN_7275
Enzymes [BR:sve01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SVEN_7275
    6.5.1.6  DNA ligase (ATP or NAD+)
     SVEN_7275
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     SVEN_7275
DNA replication proteins [BR:sve03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    SVEN_7275
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     SVEN_7275
DNA repair and recombination proteins [BR:sve03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     SVEN_7275
   NER (nucleotide excision repair)
    Other NER factors
     SVEN_7275
   MMR (mismatch exicision repair)
    Other MMR factors
     SVEN_7275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N RNA_ligase PNKP_ligase
Motif
Other DBs
NCBI-ProteinID: CCA60561
UniProt: F2R1P4
LinkDB All DBs
Position
8005468..8007015
Genome map
AA seq 515 aa AA seqDB search
MLLARVAEVSREVAAASARSRKTALLAALFAEAEPEESPLVIAYLSGRLPQGRIGVGWSV
LKEVVPPAVPPAERPELTLGRVDEVLTELAGVSGAGSRAARTRLVHGLFAAATLDEQQLL
LRLLTGEVRQGALDAIALEGVAQAATVPAAELRRAVMLEGSLPPVAQAVLAEGATALDRF
TLRVGNPVQPMLAHTAGSVTEAIAALGPCVVEEKLDGIRVQIHRSGDDVRIHTRSLDDIT
ARLPEVVAAARAVPADAFILDGEVIALDPDTGRPVSFQSIASRVGSRTDVAGAHATLPLT
AVFFDVLAVEGEGLIDRPGHERHEVLARLLPDAQRVRRFVVTDPADPEQTAAAERFFADT
LARGHEGVLVKATAAPYVAGRRGRTWLKVKPVHTVDLVVLAVERGHGRRTGLLSNLHLGA
RTAEGDFVMLGKTFKGLTDEMLRWQTERLGELAVEDDGFTVRVRPELVVEIAYDGLQRST
RYPAGVTLRFARVLRHRPDKRASEADTVAEITGRG
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcgcccgtgtcgccgaggtgtcccgggaggtcgcggccgcctccgcgcgctcg
cggaagaccgccctgctcgccgcgctgttcgcggaggccgagccggaggagagcccgctc
gtcatcgcgtacctgtccggccgcctgccgcagggacggatcggcgtcgggtggagcgtg
ctcaaggaggtggtcccgcccgccgtgccacccgccgaacggcccgagctcaccctcggg
cgcgtcgacgaggtgctgacggagctcgccggggtctccggcgcgggctcccgggccgca
cgcacccggctcgtgcacggcctcttcgccgccgcgaccctcgacgaacagcaactcctg
ctgcggctgctgaccggggaggtgcgccagggcgccctggacgccatcgccctcgaaggc
gtcgcccaggccgccaccgtgcccgcggccgagctgcgccgcgccgtgatgctcgaaggc
tcgctgcccccggtcgcccaggcggtgctcgcggagggagccaccgcgctcgaccggttc
accctgcgggtcggcaaccccgtgcagcccatgctggcgcacaccgccggctccgtcacc
gaggcgatcgcggccctcggaccctgtgtcgtcgaggagaaactcgacggcatccgcgtc
cagatccatcgcagcggcgacgacgtccgtatccacacgcgttccctcgacgacatcacc
gcccggctccccgaggtggtggcggccgcccgcgccgtacccgccgacgcgttcatcctg
gacggcgaggtgatcgccctcgaccccgacaccggacggcccgtgtcgttccagtcgatc
gcctcccgggtgggctcgcgcaccgacgtggccggggcgcacgccacgctccccctcacc
gccgtcttcttcgacgtcctcgcggtcgagggcgaagggctgatcgaccggccgggccac
gaacggcacgaggtgctcgcccggctgctccccgacgcgcagcgcgtccgccgcttcgtc
gtcaccgatccggcggaccccgagcagacggcggcggccgagcggttcttcgccgacacg
ctggcgcgcgggcacgaaggcgtcctggtcaaggcgacggccgcgccgtacgtggctggt
cgcaggggccgcacctggctgaaggtgaaaccggtccacaccgtcgacctcgtcgtgctc
gccgtcgagcgggggcatggccgcaggaccgggctgctgtccaacctccacctcggcgcc
cgcaccgccgaaggagacttcgtcatgctggggaagacgttcaaagggctcaccgacgag
atgctgcgctggcagaccgagcggctcggtgaactcgccgtggaggacgacgggttcacc
gtacgggtgcggcccgagctcgtcgtggagatcgcctacgacgggctccagcgttcgacc
cgctatccggccggggtcaccctccgcttcgcccgcgtcctgcgccaccgccccgacaag
cgggcctccgaggccgacaccgtcgcggagatcaccggtcgcggctga

DBGET integrated database retrieval system