KEGG   Saccharomonospora viridis: Svir_05660Help
Entry
Svir_05660        CDS       T00980                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
svi  Saccharomonospora viridis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Pkinase_fungal Kinase-like KfrA_N Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: ACU95637
UniProt: C7MUS4
LinkDB All DBs
Position
complement(577075..578334)
Genome map
AA seq 419 aa AA seqDB search
MERVSAPTDDRRLVAGRYRLRSVLGSGSMGTVWSAYDEFLHRPVAVKEVRLPPGVPPARV
TELRERTLREARAIAVLSHPNVVILHDVVREHGDPYVVMELLPSRSLAGLLSQMGRLTVA
QTAAVGEAVAAALEAAHTAGITHRDVKPGNVLVSDDGRIKLTDFGIARNVSEATMTHTGM
MLGSPAFIAPEVATGGPVTYTADLWGLGATLFAASEGRPPYDADGDPLETVVSVVQGDVP
RPSPGPLAPVIRGLMMKKPSERMSLAEVRRRLHPLLTQPRHTLFPAELFTESEVSRVRDE
ASVTRVIPKVPALPEEPDTEDVSAPAGGALAADPGPLPFATDDEPASSSRSTRTSRPPRE
SAHAKRSSLWPSWLPRPNTELLTGLPGTLTERRNVLAAAVVVFVLAAALGFALTRLLAG
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgtgtccgccccgacagatgaccgacgactcgtggccggccgctaccggctg
cggtccgtcctcggctccggatcgatgggcaccgtgtggtcggcctacgacgagttcctg
caccgccccgtcgcggtgaaagaggtacgactgccacccggtgtcccgccggcccgggtc
accgagctgcgtgaacggacactgcgcgaggccagggccatcgcggtgctgtcacatccg
aacgtggtgatcctgcacgacgtcgtccgtgaacacggcgacccgtacgtcgtgatggag
ctgctcccctctcgcagcctggccggattgctaagtcagatgggcagactgaccgtcgcg
cagacagcggccgtcggtgaggccgtcgccgccgcgttggaggccgcccacaccgcgggc
atcacccaccgcgacgtcaaaccgggcaacgtgttggtctcggacgacggacgcatcaag
ctcaccgatttcggcatcgcgcgcaacgtctccgaggcgacgatgacccacacgggcatg
atgctcgggtcaccggcgttcatcgcccccgaggtcgccaccggcggacccgtgacctac
acggccgacctgtggggtctgggcgccaccctgttcgccgcctccgaaggacgcccaccg
tacgacgccgacggcgatccgctggagacagtggtcagcgtggtacaaggcgacgtgcct
cgcccctcccccggaccactggctccggtgatccggggcctgatgatgaagaaaccgtcg
gagcgcatgtcactggccgaagtacggcgtcgacttcatccgctgctgacccaaccccgg
cacacgttgtttccggccgaactgttcaccgagagcgaggtcagccgagtccgcgacgag
gcgagcgtcacgcgcgtgatccccaaggtccccgcgcttccggaggaaccggacaccgag
gacgtcagcgcgcccgcgggcggcgcgctggccgccgatcccggcccactgccgttcgcc
acggacgatgagcccgcctcatcgagcaggagcacccgaacgtcccgacctccccgggaa
tccgcccatgcgaagcggtcctcgctgtggccctcctggctaccccgaccgaacaccgaa
ctgctcaccggtctgccgggaacgctcaccgagcgcaggaacgtcctggccgcggccgtc
gtggtgttcgtcctcgccgccgcactcggcttcgccctcactcggcttctcgccggctga

DBGET integrated database retrieval system